Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_025_H20 (881 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P64963|YM67_MYCTU Hypothetical protein Rv2267c/MT2329 >g... 32 1.8 sp|Q8D2R2|ISPH_WIGBR 4-hydroxy-3-methylbut-2-enyl diphospha... 31 5.2 sp|P41357|L_RINDR Large structural protein (L protein) (Tra... 30 6.8 sp|Q6YR87|TILS_ONYPE tRNA(Ile)-lysidine synthase (tRNA(Ile)... 30 8.9 sp|P14385|MTTA_THEAQ Modification methylase TaqI (Adenine-s... 30 8.9
>sp|P64963|YM67_MYCTU Hypothetical protein Rv2267c/MT2329 sp|P64964|YM90_MYCBO Hypothetical protein Mb2290c Length = 388 Score = 32.3 bits (72), Expect = 1.8 Identities = 19/65 (29%), Positives = 31/65 (47%) Frame = +1 Query: 472 YSIVPYIIEAVREGLTVHGRKQATWDDPTDWIVRSWPWNDLHSSLPISNNPIDPSNLIRL 651 Y + P I + +HG +Q T+D D +V ++ DL+ L +DP+ L Sbjct: 245 YVVYPSTIHLHKALYRIHGLQQPTFDGLDDKVVSTYV--DLYRKLDEGRELVDPTRFYEL 302 Query: 652 RPEDV 666 R ED+ Sbjct: 303 RYEDL 307
>sp|Q8D2R2|ISPH_WIGBR 4-hydroxy-3-methylbut-2-enyl diphosphate reductase Length = 315 Score = 30.8 bits (68), Expect = 5.2 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 67 HHVSSFSEIFNSFLSIQHIRSPFVIGTMSQSNSPNTK 177 H + S++ + + I H P +IGT+ Q N+PN K Sbjct: 104 HEIKRASKLRSEVIIIGHKNHPEIIGTIGQYNNPNKK 140
>sp|P41357|L_RINDR Large structural protein (L protein) (Transcriptase) (Replicase) [Includes: RNA-directed RNA polymerase ; mRNA (guanine-N(7)-)-methyltransferase ; mRNA guanylyltransferase ] Length = 2183 Score = 30.4 bits (67), Expect = 6.8 Identities = 23/90 (25%), Positives = 39/90 (43%), Gaps = 5/90 (5%) Frame = +1 Query: 334 IYIVWQHINKFLESYSSADVTIGPRLFLNCPMNVDNAKAWFVDLWNYSIVPYIIEA---- 501 +Y+ H L+S+++ D ++F+ PM + + LW S +PY+ A Sbjct: 705 LYVSDPHCPPDLDSHANLDNVPNDQIFIKYPMG--GIEGYCQKLWTISTIPYLYLAAHES 762 Query: 502 -VREGLTVHGRKQATWDDPTDWIVRSWPWN 588 VR V G Q T + SWP++ Sbjct: 763 GVRIASLVQGDNQTI--AVTKRVPSSWPYH 790
>sp|Q6YR87|TILS_ONYPE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 436 Score = 30.0 bits (66), Expect = 8.9 Identities = 22/75 (29%), Positives = 34/75 (45%) Frame = +1 Query: 1 PQSDSNVSPTSSLPLVIILDNLHHVSSFSEIFNSFLSIQHIRSPFVIGTMSQSNSPNTKN 180 P + ++P +L LVI D + + I SF+ IQ+I + N+P N Sbjct: 236 PPNSFALAPFLNLDLVIQKDIILLLLEQQNITKSFIFIQNI--------IKGINNPYKPN 287 Query: 181 LQLHHNFRWVLCTNH 225 L H NF W L ++ Sbjct: 288 LSWHLNFEWHLIKDY 302
>sp|P14385|MTTA_THEAQ Modification methylase TaqI (Adenine-specific methyltransferase TaqI) (M.TaqI) Length = 421 Score = 30.0 bits (66), Expect = 8.9 Identities = 17/63 (26%), Positives = 32/63 (50%) Frame = +1 Query: 460 DLWNYSIVPYIIEAVREGLTVHGRKQATWDDPTDWIVRSWPWNDLHSSLPISNNPIDPSN 639 +L ++ P+++ A +G V A WD+ R++PW + LP +DPS+ Sbjct: 321 ELRDFYATPHLVVAHTKGTRV----VAAWDE------RAYPWREEFHLLPKEGVRLDPSS 370 Query: 640 LIR 648 L++ Sbjct: 371 LVQ 373
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,322,980 Number of Sequences: 369166 Number of extensions: 2093351 Number of successful extensions: 4899 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4898 length of database: 68,354,980 effective HSP length: 110 effective length of database: 48,034,130 effective search space used: 8790245790 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)