Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_025_H14 (713 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q924T7|RNF31_MOUSE RING finger protein 31 37 0.068 sp|Q96EP0|RNF31_HUMAN RING finger protein 31 (Zinc in-betwe... 35 0.15 sp|Q9BYM8|UB7I3_HUMAN Ubiquitin-conjugating enzyme 7-intera... 33 0.76 sp|Q5QJC4|DCR1A_CHICK DNA cross-link repair 1A protein (chS... 33 0.76 sp|Q62921|UB7I3_RAT Ubiquitin-conjugating enzyme 7-interact... 32 2.2 sp|Q9UGI0|TRABD_HUMAN TRABID protein (Zinc finger Ran-bindi... 31 2.9 sp|Q8IY57|YAF2_HUMAN YY1-associated factor 2 31 2.9 sp|P06455|VE1_FPVL Replication protein E1 31 3.7 sp|Q8S9K3|VAR3_ARATH Zinc finger protein VAR3, chloroplast ... 31 3.7 sp|Q9WUB0|UB7I3_MOUSE Ubiquitin-conjugating enzyme 7-intera... 30 4.9
>sp|Q924T7|RNF31_MOUSE RING finger protein 31 Length = 1066 Score = 36.6 bits (83), Expect = 0.068 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +3 Query: 540 TENLRRDDDGEKWICLQCTFANESANLNCIICEHAR 647 T L + ++W C CTF NE+A + C ICE R Sbjct: 336 TGGLEPEPARDQWACQSCTFENEAAAVLCAICERPR 371
>sp|Q96EP0|RNF31_HUMAN RING finger protein 31 (Zinc in-between-RING-finger ubiquitin-associated domain protein) Length = 1072 Score = 35.4 bits (80), Expect = 0.15 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 540 TENLRRDDDGEKWICLQCTFANESANLNCIICEHAR 647 T L D +W C CTF NE+A + C ICE R Sbjct: 342 TGGLEPDLARGRWACQSCTFENEAAAVLCSICERPR 377
Score = 30.4 bits (67), Expect = 4.9 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 576 WICLQCTFANESANLNCIIC 635 W C+ CTF N S C++C Sbjct: 413 WYCIHCTFCNSSPGWVCVMC 432
>sp|Q9BYM8|UB7I3_HUMAN Ubiquitin-conjugating enzyme 7-interacting protein 3 (Hepatitis B virus X-associated protein 4) (HBV-associated factor 4) (RING finger protein 54) Length = 500 Score = 33.1 bits (74), Expect = 0.76 Identities = 38/153 (24%), Positives = 56/153 (36%), Gaps = 12/153 (7%) Frame = +3 Query: 225 TFRDIKEKIWQEIGFPMNKQLIIFNNAMQPDPSRLEQAACNQADDCLDGKEMFLYLLHGF 404 T +K+ ++ + GFP Q + + D L Q +G +LYLL Sbjct: 70 TVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQ-----NGDSAYLYLLSAR 124 Query: 405 ECGKENEIANSIGEFLLERKMKCQEALS-KSIAV-------PEPIKHFVAQRPTENLRRD 560 + E ER+++ E L K + + P P K V Q P + D Sbjct: 125 NTSLNPQ------ELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRG-QPD 177 Query: 561 DDGEK----WICLQCTFANESANLNCIICEHAR 647 E W C CTF N+ C +C AR Sbjct: 178 AVPEPPPVGWQCPGCTFINKPTRPGCEMCCRAR 210
>sp|Q5QJC4|DCR1A_CHICK DNA cross-link repair 1A protein (chSNM1A) Length = 972 Score = 33.1 bits (74), Expect = 0.76 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 7/55 (12%) Frame = +3 Query: 429 ANSIGEFLL-------ERKMKCQEALSKSIAVPEPIKHFVAQRPTENLRRDDDGE 572 A+ GE+L+ ERKM C A +KS P P++ A++P++NL+ + E Sbjct: 165 ASRAGEYLVNSTANTVERKMTCSTA-AKSSCFPSPVEDSQAEKPSKNLKNVPNNE 218
>sp|Q62921|UB7I3_RAT Ubiquitin-conjugating enzyme 7-interacting protein 3 (RBCC protein interacting with PKC) (Protein kinase C-binding protein beta-15) Length = 498 Score = 31.6 bits (70), Expect = 2.2 Identities = 33/152 (21%), Positives = 55/152 (36%), Gaps = 11/152 (7%) Frame = +3 Query: 225 TFRDIKEKIWQEIGFPMNKQLIIFNNAMQPDPSRLEQAACNQADDCLDGKEMFLYLLHGF 404 T +K+ ++ + GFP + Q + + D L + +G +LYLL Sbjct: 70 TVASLKDMVFLDYGFPPSLQQWVVGQRLARDQETLHSHGIRR-----NGDSAYLYLLSAR 124 Query: 405 ECGKENEIANSIGEFLLERKMKCQEALS-KSIAV----------PEPIKHFVAQRPTENL 551 + E +R+++ E L K + + P+P H +P Sbjct: 125 NTSLNPQ------ELQRQRQLRMLEDLGFKDLTLQPRGPLEPVLPKPRTHQETGQPDAAP 178 Query: 552 RRDDDGEKWICLQCTFANESANLNCIICEHAR 647 G W C CTF N+ C +C AR Sbjct: 179 ESPPVG--WQCPGCTFINKPTRPGCEMCCRAR 208
>sp|Q9UGI0|TRABD_HUMAN TRABID protein (Zinc finger Ran-binding domain containing 1) Length = 708 Score = 31.2 bits (69), Expect = 2.9 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 570 EKWICLQCTFANESANLNCIICEHAR 647 + W C CT+ N + C++C+H R Sbjct: 151 QHWTCSVCTYENWAKAKRCVVCDHPR 176
>sp|Q8IY57|YAF2_HUMAN YY1-associated factor 2 Length = 180 Score = 31.2 bits (69), Expect = 2.9 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +3 Query: 534 RPTENLRRDDDGEKWICLQCTFANESANLNCIICE 638 RP + + D W C CTF N + C++C+ Sbjct: 9 RPKRHAKPSSDEGYWDCSVCTFRNSAEAFKCMMCD 43
>sp|P06455|VE1_FPVL Replication protein E1 Length = 152 Score = 30.8 bits (68), Expect = 3.7 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +3 Query: 369 GKEMFLYLLHGFECGKENEIANSIGEFLLERKMKCQEALSKSIAVP 506 GK MF Y L F G ANS F L+ +C+ AL + +P Sbjct: 54 GKSMFAYSLIKFLNGSVLSFANSKSHFWLQPLTECKAALIDDVTLP 99
>sp|Q8S9K3|VAR3_ARATH Zinc finger protein VAR3, chloroplast precursor (VARIEGATED 3 protein) Length = 758 Score = 30.8 bits (68), Expect = 3.7 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 552 RRDDDGEKWICLQCTFANESANLNCIICEHAR 647 +R G +W C QC F N N+ C+ C+ R Sbjct: 305 KRQLTGSEWECPQCDFYNYGRNVACLRCDCKR 336
>sp|Q9WUB0|UB7I3_MOUSE Ubiquitin-conjugating enzyme 7-interacting protein 3 (UbcM4-interacting protein 28) Length = 498 Score = 30.4 bits (67), Expect = 4.9 Identities = 29/144 (20%), Positives = 53/144 (36%), Gaps = 3/144 (2%) Frame = +3 Query: 225 TFRDIKEKIWQEIGFPMNKQLIIFNNAMQPDPSRLEQAACNQADDCLDGKEMFLYLLHGF 404 T +K+ ++ + GFP + Q + + D L + +G +LYLL Sbjct: 70 TVASLKDMVFLDYGFPPSLQQWVVGQRLARDQETLHSHGIRR-----NGDGAYLYLLSAR 124 Query: 405 ECGKENEIANSIGEFLLERKMKCQEALSKSIAVPEPI--KHFVAQRPTE-NLRRDDDGEK 575 + + + + ++ +S EP+ K Q P + + + Sbjct: 125 NTSLNPQELQRQRQLRMLEDLGFKDLTLQSRGPLEPVLPKPRTNQEPGQPDAAPESPPVG 184 Query: 576 WICLQCTFANESANLNCIICEHAR 647 W C CTF N+ C +C AR Sbjct: 185 WQCPGCTFINKPTRPGCEMCCRAR 208
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,032,900 Number of Sequences: 369166 Number of extensions: 1518465 Number of successful extensions: 3447 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3447 length of database: 68,354,980 effective HSP length: 107 effective length of database: 48,588,335 effective search space used: 6316483550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)