Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_025_A17-2 (123 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9JIA9|CATR_MOUSE Cathepsin R precursor 28 5.0 sp|Q9MUR3|TILS_MESVI tRNA(Ile)-lysidine synthase (tRNA(Ile)... 28 5.0
>sp|Q9JIA9|CATR_MOUSE Cathepsin R precursor Length = 334 Score = 28.5 bits (62), Expect = 5.0 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = +1 Query: 49 IINEEFNAEWQVFKTKFNKNYT 114 +++ +AEWQ +K K+NK+Y+ Sbjct: 20 VLDSSLDAEWQDWKIKYNKSYS 41
>sp|Q9MUR3|TILS_MESVI tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 310 Score = 28.5 bits (62), Expect = 5.0 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 7/40 (17%) Frame = +1 Query: 19 EFTQFITSHLIINEEFNAEWQ-------VFKTKFNKNYTA 117 +F Q +T H +INEE EW+ F K+N TA Sbjct: 82 DFYQIVTCHQLINEEKAREWRYQKIEDIAFSNKYNVIVTA 121
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,494,146 Number of Sequences: 369166 Number of extensions: 117779 Number of successful extensions: 380 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 380 length of database: 68,354,980 effective HSP length: 14 effective length of database: 65,768,690 effective search space used: 1709985940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)