Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_025_A05 (606 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q58295|DPOL_METJA DNA polymerase [Contains: Mja pol-1 in... 31 2.8 sp|Q8N3Y1|FBXW8_HUMAN F-box/WD-repeat protein 8 (F-box and ... 30 3.6 sp|P51542|CP7A1_RABIT Cytochrome P450 7A1 (Cholesterol 7-al... 30 4.8 sp|Q5HEQ1|RECX_STAAC Regulatory protein recX >gi|27805680|s... 30 6.2 sp|P66003|RECX_STAAN Regulatory protein recX >gi|54041803|s... 30 6.2
>sp|Q58295|DPOL_METJA DNA polymerase [Contains: Mja pol-1 intein; Mja pol-2 intein] Length = 1634 Score = 30.8 bits (68), Expect = 2.8 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +2 Query: 374 EILDLVKDLLRLENDPAKLQRISKLLNDLNRRGYSFEKLRK 496 +I + + DL+R D K IS++L N + +SF+K+ K Sbjct: 902 KIGEYIDDLMRKHKDKIKFSGISEILETKNLKTFSFDKITK 942
>sp|Q8N3Y1|FBXW8_HUMAN F-box/WD-repeat protein 8 (F-box and WD-40 domain protein 8) (F-box only protein 29) Length = 598 Score = 30.4 bits (67), Expect = 3.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 369 KRLFTVENIFSGIVCSSVSKRPPTIFVSGNPD 274 +RL + N+ C ++S PP + VSGN D Sbjct: 423 RRLLKLGNVLRDFTCVNLSDSPPNLMVSGNMD 454
>sp|P51542|CP7A1_RABIT Cytochrome P450 7A1 (Cholesterol 7-alpha-monooxygenase) (CYPVII) (Cholesterol 7-alpha-hydroxylase) Length = 501 Score = 30.0 bits (66), Expect = 4.8 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%) Frame = +2 Query: 332 IPLNIFSTVKSLLNEILDLVK-DLLRLENDPAKLQRISKLLNDLNRRGYSFEKLRKNISE 508 +P++IF T + ++ + +K D LR + ++L R+ LND + EK + +++ Sbjct: 220 LPIHIFMTAHNAREKLAEGLKHDNLRTRDHISELIRLRMFLNDTLSTFDAMEKAKTHLAI 279 Query: 509 MWISK 523 +W S+ Sbjct: 280 LWASQ 284
>sp|Q5HEQ1|RECX_STAAC Regulatory protein recX sp|Q8NVU3|RECX_STAAW Regulatory protein recX sp|Q6G861|RECX_STAAS Regulatory protein recX Length = 272 Score = 29.6 bits (65), Expect = 6.2 Identities = 18/74 (24%), Positives = 41/74 (55%), Gaps = 4/74 (5%) Frame = +2 Query: 311 LDTLEQTIPLNIFSTVKSLLNEILDLVKDLLRLENDPAKL----QRISKLLNDLNRRGYS 478 ++T+ + F+ +++L+++L +DL ++ N K + ISK + L R+GY Sbjct: 194 METIHAVLNEMDFTQDEAVLDDLLQ--RDLEKIYNKNRKKYTQQKLISKTIEGLMRKGYK 251 Query: 479 FEKLRKNISEMWIS 520 ++K++ + E I+ Sbjct: 252 YDKIKAKLEESGIA 265
>sp|P66003|RECX_STAAN Regulatory protein recX sp|P66002|RECX_STAAM Regulatory protein recX sp|Q6GFI4|RECX_STAAR Regulatory protein recX Length = 272 Score = 29.6 bits (65), Expect = 6.2 Identities = 18/74 (24%), Positives = 41/74 (55%), Gaps = 4/74 (5%) Frame = +2 Query: 311 LDTLEQTIPLNIFSTVKSLLNEILDLVKDLLRLENDPAKL----QRISKLLNDLNRRGYS 478 ++T+ + F+ +++L+++L +DL ++ N K + ISK + L R+GY Sbjct: 194 METIHAVLNEMDFTQDEAVLDDLLQ--RDLEKIYNKNRKKYTQQKLISKTIEGLMRKGYK 251 Query: 479 FEKLRKNISEMWIS 520 ++K++ + E I+ Sbjct: 252 YDKIKAKLEESGIA 265
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,644,302 Number of Sequences: 369166 Number of extensions: 832210 Number of successful extensions: 2942 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2941 length of database: 68,354,980 effective HSP length: 105 effective length of database: 48,957,805 effective search space used: 4699949280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)