Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_024_M08 (175 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P18943|COX1_CHICK Cytochrome c oxidase subunit 1 (Cytoch... 73 2e-13 sp|P24984|COX1_COTJA Cytochrome c oxidase subunit 1 (Cytoch... 73 2e-13 sp|Q94WR7|COX1_BUTBU Cytochrome c oxidase subunit 1 (Cytoch... 71 9e-13 sp|O21399|COX1_STRCA Cytochrome c oxidase subunit 1 (Cytoch... 69 3e-12 sp|Q9MIY8|COX1_BRARE Cytochrome c oxidase subunit 1 (Cytoch... 64 8e-11 sp|P24985|COX1_CYPCA Cytochrome c oxidase subunit 1 (Cytoch... 63 2e-10 sp|Q36775|COX1_GADMO Cytochrome c oxidase subunit 1 (Cytoch... 62 4e-10 sp|P48170|COX1_ONCMY Cytochrome c oxidase subunit 1 (Cytoch... 61 7e-10 sp|O78681|COX1_CARAU Cytochrome c oxidase subunit 1 (Cytoch... 61 7e-10 sp|P34188|COX1_CROLA Cytochrome c oxidase subunit 1 (Cytoch... 60 1e-09
>sp|P18943|COX1_CHICK Cytochrome c oxidase subunit 1 (Cytochrome c oxidase polypeptide I) Length = 515 Score = 73.2 bits (178), Expect = 2e-13 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 3 VLQPELTATNIE*IHGCPPPYHTFEEPAFVQVQE 104 VLQPELTATNIE IHGCPPPYHTFEEPAFVQVQE Sbjct: 482 VLQPELTATNIEWIHGCPPPYHTFEEPAFVQVQE 515
>sp|P24984|COX1_COTJA Cytochrome c oxidase subunit 1 (Cytochrome c oxidase polypeptide I) Length = 516 Score = 73.2 bits (178), Expect = 2e-13 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 3 VLQPELTATNIE*IHGCPPPYHTFEEPAFVQVQE 104 VLQPELTATNIE IHGCPPPYHTFEEPAFVQVQE Sbjct: 483 VLQPELTATNIEWIHGCPPPYHTFEEPAFVQVQE 516
>sp|Q94WR7|COX1_BUTBU Cytochrome c oxidase subunit 1 (Cytochrome c oxidase polypeptide I) Length = 516 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 3 VLQPELTATNIE*IHGCPPPYHTFEEPAFVQVQE 104 +LQPELT TN+E IHGCPPPYHTFEEPAFVQVQE Sbjct: 483 ILQPELTTTNVEWIHGCPPPYHTFEEPAFVQVQE 516
>sp|O21399|COX1_STRCA Cytochrome c oxidase subunit 1 (Cytochrome c oxidase polypeptide I) Length = 516 Score = 68.9 bits (167), Expect = 3e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 3 VLQPELTATNIE*IHGCPPPYHTFEEPAFVQVQE 104 VLQPEL ATNIE IHGCPPP+HTFEEPAFVQVQE Sbjct: 483 VLQPELIATNIEWIHGCPPPHHTFEEPAFVQVQE 516
>sp|Q9MIY8|COX1_BRARE Cytochrome c oxidase subunit 1 (Cytochrome c oxidase polypeptide I) Length = 516 Score = 64.3 bits (155), Expect = 8e-11 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 3 VLQPELTATNIE*IHGCPPPYHTFEEPAFVQVQ 101 VL ELTATN+E +HGCPPPYHTFEEPAFVQ+Q Sbjct: 482 VLSVELTATNVEWLHGCPPPYHTFEEPAFVQIQ 514
>sp|P24985|COX1_CYPCA Cytochrome c oxidase subunit 1 (Cytochrome c oxidase polypeptide I) Length = 516 Score = 63.2 bits (152), Expect = 2e-10 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 3 VLQPELTATNIE*IHGCPPPYHTFEEPAFVQVQ 101 VL ELTATN+E +HGCPPPYHT+EEPAFVQ+Q Sbjct: 482 VLSVELTATNVEWLHGCPPPYHTYEEPAFVQIQ 514
>sp|Q36775|COX1_GADMO Cytochrome c oxidase subunit 1 (Cytochrome c oxidase polypeptide I) Length = 516 Score = 62.0 bits (149), Expect = 4e-10 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 3 VLQPELTATNIE*IHGCPPPYHTFEEPAFVQVQER 107 V+ E+T TN+E +HGCPPPYHTFEEPAFVQ+Q R Sbjct: 482 VMAVEMTMTNVEWLHGCPPPYHTFEEPAFVQIQTR 516
>sp|P48170|COX1_ONCMY Cytochrome c oxidase subunit 1 (Cytochrome c oxidase polypeptide I) Length = 516 Score = 61.2 bits (147), Expect = 7e-10 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 15 ELTATNIE*IHGCPPPYHTFEEPAFVQVQ 101 ELT+TN+E +HGCPPPYHTFEEPAFVQVQ Sbjct: 486 ELTSTNVEWLHGCPPPYHTFEEPAFVQVQ 514
>sp|O78681|COX1_CARAU Cytochrome c oxidase subunit 1 (Cytochrome c oxidase polypeptide I) Length = 516 Score = 61.2 bits (147), Expect = 7e-10 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 3 VLQPELTATNIE*IHGCPPPYHTFEEPAFVQVQ 101 VL ELT TN+E +HGCPPPYHT+EEPAFVQ+Q Sbjct: 482 VLSVELTMTNVEWLHGCPPPYHTYEEPAFVQIQ 514
>sp|P34188|COX1_CROLA Cytochrome c oxidase subunit 1 (Cytochrome c oxidase polypeptide I) Length = 516 Score = 60.5 bits (145), Expect = 1e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 3 VLQPELTATNIE*IHGCPPPYHTFEEPAFVQVQ 101 V+ ELT TN+E +HGCPPPYHTFEEPAFVQV+ Sbjct: 482 VMSVELTMTNVEWLHGCPPPYHTFEEPAFVQVR 514
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,335,867 Number of Sequences: 369166 Number of extensions: 435630 Number of successful extensions: 1564 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1563 length of database: 68,354,980 effective HSP length: 30 effective length of database: 62,812,930 effective search space used: 1695949110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)