Dr_sW_024_M05
	
		- ACCESSION : BW642580
 
		- GO Category :
Not Available
		
 
		- EST Sequence : 
 
	
	
	
	BLASTX 2.2.12 [Aug-07-2005]
	
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.
Query= Dr_sW_024_M05
         (657 letters)
Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters
                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value
sp|P41997|YKC6_CAEEL  Hypothetical protein B0280.6 in chromo...    30   5.5  
>sp|P41997|YKC6_CAEEL Hypothetical protein B0280.6 in chromosome III
          Length = 252
 Score = 30.0 bits (66), Expect = 5.5
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = +1
Query: 34  LSDGSVNEYAVLRWYQKFRFDNTSLEE-PHARRPAVNYSEQLNQLIEADTR 183
           + +G+++      W+QKF+  + SLEE   + RP     E L +L+E + R
Sbjct: 36  MGEGALSYNTAKSWFQKFKNGDFSLEEIERSGRPVELNEEDLVKLVEEEPR 86
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 72,898,192
Number of Sequences: 369166
Number of extensions: 1401904
Number of successful extensions: 3094
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2938
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3094
length of database: 68,354,980
effective HSP length: 106
effective length of database: 48,773,070
effective search space used: 5462583840
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)