Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_024_J21 (585 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O10300|VP47_NPVOP Viral transcription regulator p47 29 7.5 sp|O14106|YEJ6_SCHPO Hypothetical protein C31G5.06 in chrom... 29 7.5
>sp|O10300|VP47_NPVOP Viral transcription regulator p47 Length = 399 Score = 29.3 bits (64), Expect = 7.5 Identities = 24/96 (25%), Positives = 41/96 (42%) Frame = +2 Query: 155 DILFTQPYKFL*LLVNEVTLKYMKSLVTLYYYSTDEFSQCESQNCKLLLTIEKIKHTSIQ 334 ++LF +F + N T SL YY ++F+ ES + L+ + I Sbjct: 273 NLLFATDVEFY-MRANHFTFYVYNSLKFYYYCLKNKFA-FESNDKMLMFLLYTIVSLEWF 330 Query: 335 THNHINSTTIKKCCCLKPYKATNQSIPNSSRAAACN 442 H+NS T++K P + + + + RAA N Sbjct: 331 NKGHLNSFTLEKSELYNPLELATRRLNSIKRAAQQN 366
>sp|O14106|YEJ6_SCHPO Hypothetical protein C31G5.06 in chromosome I Length = 145 Score = 29.3 bits (64), Expect = 7.5 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +2 Query: 275 ESQNCKLLLTIEKIKHTSIQTHNHINSTTIKKCCCLKP 388 ES LL I +K TS Q H H N I + C +P Sbjct: 17 ESLQDSLLKEISSLKETSTQNHLHCNDIKILQDCLRRP 54
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,411,850 Number of Sequences: 369166 Number of extensions: 882321 Number of successful extensions: 1790 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1790 length of database: 68,354,980 effective HSP length: 105 effective length of database: 48,957,805 effective search space used: 4357244645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)