Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_024_I10 (884 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein bet... 30 8.9 sp|Q94981|ARI1_DROME Ariadne-1 protein (Ari-1) 30 8.9
>sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein beta subunit-like protein (Cross-pathway control WD-repeat protein cpc-2) Length = 316 Score = 30.0 bits (66), Expect = 8.9 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 2/73 (2%) Frame = +2 Query: 35 INNITIASSNGAVCISRSKEGPTP--DANEIAALVKYLTSKQGSGLTYGGHKLMFTREIE 208 IN +TI S +G++C S K+G T D NE L + + L + ++ Sbjct: 195 INAVTI-SPDGSLCASGGKDGTTMLWDLNESKHLYSLNANDEIHALVFSPNRYWLCAATS 253 Query: 209 DSIMIFNIIGASK 247 SI+IF++ SK Sbjct: 254 SSIIIFDLEKKSK 266
>sp|Q94981|ARI1_DROME Ariadne-1 protein (Ari-1) Length = 503 Score = 30.0 bits (66), Expect = 8.9 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 Query: 256 CIEQNC*HQFCYSCLWSW 309 C QNC ++FC+ CL SW Sbjct: 309 CKNQNCKNEFCWVCLGSW 326
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,146,468 Number of Sequences: 369166 Number of extensions: 1564897 Number of successful extensions: 3850 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3848 length of database: 68,354,980 effective HSP length: 110 effective length of database: 48,034,130 effective search space used: 8838279920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)