Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_024_I05 (858 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q85230|CELF_PRVKA Cell fusion protein precursor (Syncyti... 30 6.6 sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 (Actin-bind... 30 6.6
>sp|Q85230|CELF_PRVKA Cell fusion protein precursor (Syncytial protein) (Glycoprotein K) Length = 312 Score = 30.4 bits (67), Expect = 6.6 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 404 GNQSLIGTKVCGGCGSTVVPGVTTKPGCFAIVMCLLIALIL 526 G ++ +G VCG C STV+ G+ K A+ +CLL+ +L Sbjct: 265 GGRAALG--VCGACCSTVLAGIFAK----ALYLCLLVGGVL 299
>sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 (Actin-binding LIM protein family member 2) (abLIM2) Length = 612 Score = 30.4 bits (67), Expect = 6.6 Identities = 24/88 (27%), Positives = 34/88 (38%), Gaps = 10/88 (11%) Frame = +2 Query: 371 CQNTKTTTIVVGNQSLI--GTKVCGGCGSTVVPGVTTKP-------GCFAIVMCLLIALI 523 CQ T+V GN + + G + CGGCG + G GCF C + Sbjct: 131 CQKCSPPTLV-GNSAHVAQGLRSCGGCGLEIKNGQALVALDKHWHLGCFKCKTCGKLLNA 189 Query: 524 LPYGCCFIPFCAAGFQDVYHI-CPNCNK 604 +P+C A + + I C C K Sbjct: 190 EYISKDGLPYCEADYHTKFGIRCDGCEK 217
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,894,731 Number of Sequences: 369166 Number of extensions: 1145406 Number of successful extensions: 3372 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3210 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3359 length of database: 68,354,980 effective HSP length: 109 effective length of database: 48,218,865 effective search space used: 8486520240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)