Dr_sW_024_H12
- ACCESSION : BW642489
- GO Category :
Not Available
- EST Sequence :
BLASTX 2.2.12 [Aug-07-2005]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= Dr_sW_024_H12
(786 letters)
Database: Non-redundant SwissProt sequences
184,735 sequences; 68,354,980 total letters
Score E
Sequences producing significant alignments: (bits) Value
sp|Q8K9Z2|SYI_BUCAP Isoleucyl-tRNA synthetase (Isoleucine--... 31 3.4
>sp|Q8K9Z2|SYI_BUCAP Isoleucyl-tRNA synthetase (Isoleucine--tRNA ligase) (IleRS)
Length = 938
Score = 31.2 bits (69), Expect = 3.4
Identities = 16/63 (25%), Positives = 32/63 (50%)
Frame = -2
Query: 446 VNNVKRKIKYINVTPFAIRTFQNLIKK*KIYFKLNGVRIQIKTNSSIRSTREQRVCNMTL 267
+NN + VTP +T L ++ K F + V+I++ + I ST+ +++ N +
Sbjct: 834 INNSLEACLILYVTPEVKKTLNILGEELKFIFLTSKVKIELYNTAPINSTKSKKISNFKI 893
Query: 266 HIK 258
+K
Sbjct: 894 FLK 896
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 68,819,913
Number of Sequences: 369166
Number of extensions: 1152907
Number of successful extensions: 2268
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2224
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2268
length of database: 68,354,980
effective HSP length: 108
effective length of database: 48,403,600
effective search space used: 7405750800
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)