Planarian EST Database

Dr_sW_024_D14

BLASTX 2.2.12 [Aug-07-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Dr_sW_024_D14
         (609 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q9BX66|SRBS1_HUMAN  Sorbin and SH3 domain-containing prot...    31   2.8  

>sp|Q9BX66|SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 (Ponsin)
           (c-Cbl-associated protein) (CAP) (SH3 domain protein 5)
           (SH3P12)
          Length = 1292

 Score = 30.8 bits (68), Expect = 2.8
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = +3

Query: 315 PDLTGAVQASDPN-FLNRIGMTYALTNNPGGPAVYRNSSSY 434
           PDLTGAV ++D +  LN +  +   T++   P+V + SS+Y
Sbjct: 261 PDLTGAVSSTDSSPLLNEVSSSLIGTDSQAFPSVSKPSSAY 301

  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 61,170,565
Number of Sequences: 369166
Number of extensions: 1118350
Number of successful extensions: 2892
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2800
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2887
length of database: 68,354,980
effective HSP length: 105
effective length of database: 48,957,805
effective search space used: 4748907085
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)