Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_024_A16 (143 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8M355|RMAR_SACCA Mitochondrial ribosomal protein VAR1 28 6.4 sp|Q9X170|YD49_THEMA Hypothetical UPF0118 protein TM1349 28 8.4
>sp|Q8M355|RMAR_SACCA Mitochondrial ribosomal protein VAR1 Length = 326 Score = 28.1 bits (61), Expect = 6.4 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 7 MTKMTSGNILKHQMVPNLNITENKYIN 87 MTKM + NI+ + M N+ NKYIN Sbjct: 214 MTKMNNNNIIMNYMNNMNNMRNNKYIN 240
>sp|Q9X170|YD49_THEMA Hypothetical UPF0118 protein TM1349 Length = 338 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -1 Query: 116 LKKMSLVVKKLIYLFSVIFKFGTIWCFKIFPDVIFVIV 3 +K+ +++ + F+ ++ + FKIFPDV VIV Sbjct: 1 MKEFRKILEDKAFFFTTLYILISFLVFKIFPDVFAVIV 38
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,227,920 Number of Sequences: 369166 Number of extensions: 207181 Number of successful extensions: 537 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 537 length of database: 68,354,980 effective HSP length: 21 effective length of database: 64,475,545 effective search space used: 1676364170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)