Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_023_O18 (230 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P32217|VC18_SWPVK Hypothetical protein C18 28 6.7 sp|Q9L0D7|RL2_STRCO 50S ribosomal protein L2 28 8.7
>sp|P32217|VC18_SWPVK Hypothetical protein C18 Length = 67 Score = 28.1 bits (61), Expect = 6.7 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -3 Query: 228 LIDLFCYYFYIVKFCIYFHVSWVPVFYKDLVHCNYHRFQY 109 L FCY+FYI K I H + Y L C ++++Y Sbjct: 20 LYSSFCYFFYIEK--ILQHTKPIYTNYGQLCICKINKYKY 57
>sp|Q9L0D7|RL2_STRCO 50S ribosomal protein L2 Length = 278 Score = 27.7 bits (60), Expect = 8.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 150 KRREPKKHENKYRTSRYKSNNKR 218 + R PKK NKY R K+N KR Sbjct: 256 RTRSPKKASNKYIVRRRKTNKKR 278
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,305,033 Number of Sequences: 369166 Number of extensions: 273193 Number of successful extensions: 876 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 854 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 876 length of database: 68,354,980 effective HSP length: 47 effective length of database: 59,672,435 effective search space used: 1730500615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)