Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_023_N09 (471 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q6VZQ4|V27K_CNPV 27 kDa virion core protein 32 0.95 sp|Q8TRL2|MRE11_METAC DNA double-strand break repair protei... 30 2.1 sp|Q8PUY5|MRE11_METMA DNA double-strand break repair protei... 30 2.8 sp|Q59185|LON1_BORBU ATP-dependent protease La 28 8.1
>sp|Q6VZQ4|V27K_CNPV 27 kDa virion core protein Length = 267 Score = 31.6 bits (70), Expect = 0.95 Identities = 19/49 (38%), Positives = 30/49 (61%) Frame = +3 Query: 24 LIQTLKKILKVFSMK*IIVHVQNRMPKSREEVQMPNLVVDREDYLKGVQ 170 LI+TLK+I+ + S V V N + SR+ +++ N DRED+L V+ Sbjct: 191 LIETLKEIVTINSEDIWKVIVSNDIFDSRDVIKLINFDYDREDFLSFVR 239
>sp|Q8TRL2|MRE11_METAC DNA double-strand break repair protein mre11 Length = 614 Score = 30.4 bits (67), Expect = 2.1 Identities = 20/57 (35%), Positives = 31/57 (54%) Frame = +3 Query: 138 VDREDYLKGVQLIVNVGRVEVQVKALVDAQLSEGDLKDVEAQVLQRALSARSIISRL 308 V R+D+ K + ++ V++QV A+V A GDL D L+ L +I+SRL Sbjct: 24 VRRQDFFKAFETVIQ-DAVDMQVDAVVHA----GDLFDSRNPTLEDLLETMNILSRL 75
>sp|Q8PUY5|MRE11_METMA DNA double-strand break repair protein mre11 Length = 617 Score = 30.0 bits (66), Expect = 2.8 Identities = 19/57 (33%), Positives = 31/57 (54%) Frame = +3 Query: 138 VDREDYLKGVQLIVNVGRVEVQVKALVDAQLSEGDLKDVEAQVLQRALSARSIISRL 308 V R+D+ K + ++ V++QV A+V A GDL D L+ L +++SRL Sbjct: 24 VRRQDFFKAFETVIK-DAVDMQVDAVVHA----GDLFDSRNPTLEDLLETMNVLSRL 75
>sp|Q59185|LON1_BORBU ATP-dependent protease La Length = 806 Score = 28.5 bits (62), Expect = 8.1 Identities = 20/102 (19%), Positives = 51/102 (50%), Gaps = 7/102 (6%) Frame = +3 Query: 15 HQFLIQTL------KKILKVFSMK*IIVHVQNRMPKS-REEVQMPNLVVDREDYLKGVQL 173 HQ +++TL KK+L++ + ++ +QN++ K +E ++ ++ LK ++ Sbjct: 211 HQIVLETLNVKDRLKKVLELIYEELNLIEIQNKIAKGIQERLEKQQKEFFLKEQLKAIKA 270 Query: 174 IVNVGRVEVQVKALVDAQLSEGDLKDVEAQVLQRALSARSII 299 + +G + + +L +LK +V+++ L S++ Sbjct: 271 ELGIGDKKSSDLEKLKTKLKALELKGEPLEVVEKELEKFSLL 312
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,712,498 Number of Sequences: 369166 Number of extensions: 552847 Number of successful extensions: 1593 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1593 length of database: 68,354,980 effective HSP length: 101 effective length of database: 49,696,745 effective search space used: 2733320975 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)