Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_023_K12-2 (252 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P77779|YBFO_ECOLI Hypothetical protein ybfO 30 2.2 sp|Q8RGP6|TYSY_FUSNN Thymidylate synthase (TS) (TSase) 28 5.0 sp|Q10415|PMIP_SCHPO Probable mitochondrial intermediate pe... 28 6.5
>sp|P77779|YBFO_ECOLI Hypothetical protein ybfO Length = 477 Score = 29.6 bits (65), Expect = 2.2 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +3 Query: 69 SHYPMQFMPPPLYEIGSIWIPKLNHIDVYNSSGVDYLSRWLAKMEQRRSLG 221 +++P +PP P +N D ++G+D L LAKM+QR S G Sbjct: 424 TNWPTTQLPPGYTCAEPYLFPDINKPDGPATAGIDDLGEILAKMKQRTSRG 474
>sp|Q8RGP6|TYSY_FUSNN Thymidylate synthase (TS) (TSase) Length = 275 Score = 28.5 bits (62), Expect = 5.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 99 PLYEIGSIWIPKLNHIDVYNSSGVDYLSRW 188 P+ E+ IWI + N++DV N G + W Sbjct: 69 PIRELYWIWILQSNNVDVLNELGCKFWDEW 98
>sp|Q10415|PMIP_SCHPO Probable mitochondrial intermediate peptidase, mitochondrial precursor (MIP) Length = 762 Score = 28.1 bits (61), Expect = 6.5 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +3 Query: 57 RGYVSHYPMQFMPPPLYEIGSIWIPKLNHIDVYNSS 164 R + S Y ++F+P + G +W P +N ++VYN + Sbjct: 419 RLFSSLYGLRFVPADISP-GEVWHPDVNKVNVYNEN 453
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,512,607 Number of Sequences: 369166 Number of extensions: 580271 Number of successful extensions: 1306 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1306 length of database: 68,354,980 effective HSP length: 54 effective length of database: 58,379,290 effective search space used: 1692999410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)