Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_023_J05 (352 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P32300|OPRD_MOUSE Delta-type opioid receptor (DOR-1) (K5... 32 0.59 sp|P33533|OPRD_RAT Delta-type opioid receptor (DOR-1) (Opio... 32 0.59 sp|P79291|OPRD_PIG Delta-type opioid receptor (DOR-1) 32 0.59 sp|P41143|OPRD_HUMAN Delta-type opioid receptor (DOR-1) 32 0.59 sp|P41144|OPRK_CAVPO Kappa-type opioid receptor (KOR-1) 31 0.77 sp|P33534|OPRK_MOUSE Kappa-type opioid receptor (KOR-1) (MS... 31 0.77 sp|P34975|OPRK_RAT Kappa-type opioid receptor (KOR-1) 31 0.77 sp|P41145|OPRK_HUMAN Kappa-type opioid receptor (KOR-1) 31 0.77 sp|P36252|RPOC_THEMA DNA-directed RNA polymerase beta' chai... 30 2.2 sp|P42866|OPRM_MOUSE Mu-type opioid receptor (MOR-1) 28 5.0
>sp|P32300|OPRD_MOUSE Delta-type opioid receptor (DOR-1) (K56) (MSL-2) Length = 372 Score = 31.6 bits (70), Expect = 0.59 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 4/34 (11%) Frame = -1 Query: 334 LICK----IDYLNVFLNLF*ITW*NVNNFISYCH 245 L+CK IDY N+F ++F +T +V+ +I+ CH Sbjct: 119 LLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCH 152
>sp|P33533|OPRD_RAT Delta-type opioid receptor (DOR-1) (Opioid receptor A) Length = 372 Score = 31.6 bits (70), Expect = 0.59 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 4/34 (11%) Frame = -1 Query: 334 LICK----IDYLNVFLNLF*ITW*NVNNFISYCH 245 L+CK IDY N+F ++F +T +V+ +I+ CH Sbjct: 119 LLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCH 152
>sp|P79291|OPRD_PIG Delta-type opioid receptor (DOR-1) Length = 228 Score = 31.6 bits (70), Expect = 0.59 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 4/34 (11%) Frame = -1 Query: 334 LICK----IDYLNVFLNLF*ITW*NVNNFISYCH 245 L+CK IDY N+F ++F +T +V+ +I+ CH Sbjct: 47 LLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCH 80
>sp|P41143|OPRD_HUMAN Delta-type opioid receptor (DOR-1) Length = 372 Score = 31.6 bits (70), Expect = 0.59 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 4/34 (11%) Frame = -1 Query: 334 LICK----IDYLNVFLNLF*ITW*NVNNFISYCH 245 L+CK IDY N+F ++F +T +V+ +I+ CH Sbjct: 119 LLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCH 152
>sp|P41144|OPRK_CAVPO Kappa-type opioid receptor (KOR-1) Length = 380 Score = 31.2 bits (69), Expect = 0.77 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -1 Query: 334 LICKIDYLNVFLNLF*ITW*NVNNFISYCH 245 ++ IDY N+F ++F +T +V+ +I+ CH Sbjct: 133 IVISIDYYNMFTSIFTLTMMSVDRYIAVCH 162
>sp|P33534|OPRK_MOUSE Kappa-type opioid receptor (KOR-1) (MSL-1) Length = 380 Score = 31.2 bits (69), Expect = 0.77 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -1 Query: 334 LICKIDYLNVFLNLF*ITW*NVNNFISYCH 245 ++ IDY N+F ++F +T +V+ +I+ CH Sbjct: 133 IVISIDYYNMFTSIFTLTMMSVDRYIAVCH 162
>sp|P34975|OPRK_RAT Kappa-type opioid receptor (KOR-1) Length = 380 Score = 31.2 bits (69), Expect = 0.77 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -1 Query: 334 LICKIDYLNVFLNLF*ITW*NVNNFISYCH 245 ++ IDY N+F ++F +T +V+ +I+ CH Sbjct: 133 IVISIDYYNMFTSIFTLTMMSVDRYIAVCH 162
>sp|P41145|OPRK_HUMAN Kappa-type opioid receptor (KOR-1) Length = 380 Score = 31.2 bits (69), Expect = 0.77 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -1 Query: 334 LICKIDYLNVFLNLF*ITW*NVNNFISYCH 245 ++ IDY N+F ++F +T +V+ +I+ CH Sbjct: 133 IVISIDYYNMFTSIFTLTMMSVDRYIAVCH 162
>sp|P36252|RPOC_THEMA DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1690 Score = 29.6 bits (65), Expect = 2.2 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +2 Query: 71 EGRIENDIPVVTIEGVDYPASEASDVKVG----EGDSCSVCHIYP 193 E R END P+V I +D S+ + +KVG E + + IYP Sbjct: 412 EERTENDRPIVVITDIDPEVSKETGLKVGDIVTENEYEAYLQIYP 456
>sp|P42866|OPRM_MOUSE Mu-type opioid receptor (MOR-1) Length = 398 Score = 28.5 bits (62), Expect = 5.0 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = -1 Query: 334 LICKIDYLNVFLNLF*ITW*NVNNFISYCH 245 ++ IDY N+F ++F + +V+ +I+ CH Sbjct: 142 IVISIDYYNMFTSIFTLCTMSVDRYIAVCH 171
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,130,730 Number of Sequences: 369166 Number of extensions: 755384 Number of successful extensions: 1802 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1801 length of database: 68,354,980 effective HSP length: 84 effective length of database: 52,837,240 effective search space used: 1690791680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)