Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_023_H20 (198 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P25417|CYTB_BOVIN Cystatin B (Stefin B) 32 0.60 sp|Q28988|CYTA1_PIG Cystatin A1 (Stefin A1) 30 1.3 sp|P35479|CPI1_PIG Leukocyte cysteine proteinase inhibitor ... 30 1.7 sp|Q28987|CYTA8_PIG Cystatin A8 (Stefin A8) 29 3.0 sp|Q28986|CYTA5_PIG Cystatin A5 (Stefin A5) 29 3.0 sp|Q8WNR9|CYTA_FELCA Cystatin A (Allergen Fel d 3) 28 5.1
>sp|P25417|CYTB_BOVIN Cystatin B (Stefin B) Length = 98 Score = 31.6 bits (70), Expect = 0.60 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 Query: 61 MLCGGTGNVRTPSEEEKTILLTVKPQIEDQIGHSCSAFDILQLRSQ 198 M+CGGT + + E + I VK Q+E++ F L+ +SQ Sbjct: 1 MMCGGTSATQPATAETQAIADKVKSQLEEKENKKFPVFKALEFKSQ 46
>sp|Q28988|CYTA1_PIG Cystatin A1 (Stefin A1) Length = 103 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +1 Query: 55 NRMLCGGTGNVRTPSEEEKTILLTVKPQIEDQIGHSCSAFDILQLRSQ 198 ++M+ GG R + E + I TVK Q+E++ + F+ ++ +SQ Sbjct: 4 DKMMPGGLTEARPATPEIQEIATTVKSQLEEKTNKTYEKFEAVEYKSQ 51
>sp|P35479|CPI1_PIG Leukocyte cysteine proteinase inhibitor 1 (PLCPI) (Stefin D1) Length = 103 Score = 30.0 bits (66), Expect = 1.7 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 61 MLCGGTGNVRTPSEEEKTILLTVKPQIEDQIGHSCSAFDILQLRSQ 198 ML GG R + E + I VKPQ+E++ + F+ + RSQ Sbjct: 6 MLAGGLTEPRPATPEIQEIANKVKPQLEEKTNKTYEKFEAIIYRSQ 51
>sp|Q28987|CYTA8_PIG Cystatin A8 (Stefin A8) Length = 103 Score = 29.3 bits (64), Expect = 3.0 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 61 MLCGGTGNVRTPSEEEKTILLTVKPQIEDQIGHSCSAFDILQLRSQ 198 ML GG R + E + I VKPQ+E++ + F+ + RSQ Sbjct: 6 MLAGGLTEPRPATPEIQEIANKVKPQLEEKTKKTYEKFEAIIYRSQ 51
>sp|Q28986|CYTA5_PIG Cystatin A5 (Stefin A5) Length = 103 Score = 29.3 bits (64), Expect = 3.0 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 61 MLCGGTGNVRTPSEEEKTILLTVKPQIEDQIGHSCSAFDILQLRSQ 198 ML GG R + E + I VKPQ+E++ + F+ + RSQ Sbjct: 6 MLAGGLTEPRPATPEIQEIANKVKPQLEEKTKKTYEKFEAIIYRSQ 51
>sp|Q8WNR9|CYTA_FELCA Cystatin A (Allergen Fel d 3) Length = 98 Score = 28.5 bits (62), Expect = 5.1 Identities = 12/46 (26%), Positives = 25/46 (54%) Frame = +1 Query: 61 MLCGGTGNVRTPSEEEKTILLTVKPQIEDQIGHSCSAFDILQLRSQ 198 M+ GG + + E + I VKPQ+E++ + F+ ++ ++Q Sbjct: 1 MIPGGLSEAKPATPEIQEIANEVKPQLEEKTNETYQKFEAIEYKTQ 46
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,481,179 Number of Sequences: 369166 Number of extensions: 279177 Number of successful extensions: 640 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 640 length of database: 68,354,980 effective HSP length: 37 effective length of database: 61,519,785 effective search space used: 1722553980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)