Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_023_H06 (231 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9VNA4|Y1161_DROME Hypothetical protein CG1161 37 0.011 sp|O73698|PUT2_FUGRU Putative protein 2 (PUT2) 29 3.9 sp|Q13418|ILK1_HUMAN Integrin-linked protein kinase 1 (ILK-... 28 6.7 sp|P57043|ILK2_HUMAN Integrin-linked protein kinase 2 (ILK-2) 28 6.7 sp|P57044|ILK_CAVPO Integrin-linked protein kinase (Beta-in... 28 6.7 sp|O55222|ILK_MOUSE Integrin-linked protein kinase 28 6.7 sp|P23665|GUNA_FIBSU Endoglucanase A precursor (Endo-1,4-be... 28 8.7
>sp|Q9VNA4|Y1161_DROME Hypothetical protein CG1161 Length = 227 Score = 37.4 bits (85), Expect = 0.011 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 4/52 (7%) Frame = +2 Query: 32 DDTVTPRM----RTKSEAMSDVVNRARYEQDRWRGTVKMQRDRVFHDHSILN 175 DD TP + + A ++V+NR ++QD+W+ V+ QR ++ H++LN Sbjct: 176 DDEPTPPLPAVNNQELSARANVLNRVGHQQDKWKRQVREQRRHIYDRHTMLN 227
>sp|O73698|PUT2_FUGRU Putative protein 2 (PUT2) Length = 187 Score = 28.9 bits (63), Expect = 3.9 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +2 Query: 35 DTVTPRMRTKSEAMSDVVNRARYEQDRWRGTVKMQRDRVFHDHSIL 172 + + P+M + V+ R Q RW+ V+ QR VF H +L Sbjct: 142 EDIQPQMSGDPARGNTVLERVEGAQQRWKKQVQEQRKTVFDRHKML 187
>sp|Q13418|ILK1_HUMAN Integrin-linked protein kinase 1 (ILK-1) (59 kDa serine/threonine-protein kinase) (p59ILK) Length = 452 Score = 28.1 bits (61), Expect = 6.7 Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +2 Query: 5 FGSITCRKPDDTVTPRMRTKSEAMSDVVNRARYEQDRWRGTVKMQ-RDRVFHDHS 166 +G + K + +R ++E M +NR Y+ W+GT + + R+ + HS Sbjct: 132 YGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHS 186
>sp|P57043|ILK2_HUMAN Integrin-linked protein kinase 2 (ILK-2) Length = 452 Score = 28.1 bits (61), Expect = 6.7 Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +2 Query: 5 FGSITCRKPDDTVTPRMRTKSEAMSDVVNRARYEQDRWRGTVKMQ-RDRVFHDHS 166 +G + K + +R ++E M +NR Y+ W+GT + + R+ + HS Sbjct: 132 YGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHS 186
>sp|P57044|ILK_CAVPO Integrin-linked protein kinase (Beta-integrin-linked kinase) Length = 451 Score = 28.1 bits (61), Expect = 6.7 Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +2 Query: 5 FGSITCRKPDDTVTPRMRTKSEAMSDVVNRARYEQDRWRGTVKMQ-RDRVFHDHS 166 +G + K + +R ++E M +NR Y+ W+GT + + R+ + HS Sbjct: 132 YGEMPMDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHS 186
>sp|O55222|ILK_MOUSE Integrin-linked protein kinase Length = 452 Score = 28.1 bits (61), Expect = 6.7 Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +2 Query: 5 FGSITCRKPDDTVTPRMRTKSEAMSDVVNRARYEQDRWRGTVKMQ-RDRVFHDHS 166 +G + K + +R ++E M +NR Y+ W+GT + + R+ + HS Sbjct: 132 YGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHS 186
>sp|P23665|GUNA_FIBSU Endoglucanase A precursor (Endo-1,4-beta-glucanase) (Cellulase) Length = 453 Score = 27.7 bits (60), Expect = 8.7 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 Query: 17 TCRKPDDTVTPRMRTKSEAMSDVVNRARYEQDRW 118 T RKP T TP K + D++ RYE D W Sbjct: 118 TTRKP--TTTPMKSGKPNKVRDLLEELRYEADFW 149
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,375,583 Number of Sequences: 369166 Number of extensions: 316372 Number of successful extensions: 688 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 686 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 688 length of database: 68,354,980 effective HSP length: 47 effective length of database: 59,672,435 effective search space used: 1730500615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)