Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_023_E15 (238 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q80WG5|LRRC8_MOUSE Leucine-rich repeat-containing protein 8 28 6.6 sp|Q8IWT6|LRRC8_HUMAN Leucine-rich repeat-containing protein 8 28 6.6
>sp|Q80WG5|LRRC8_MOUSE Leucine-rich repeat-containing protein 8 Length = 810 Score = 28.1 bits (61), Expect = 6.6 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -2 Query: 231 LHQFVKQHYHRVLMAS*CRLVANHFAHSYSYWHSYLQHFVANL*SCF 91 LH F K + VL+ + L ++F + S L+HFV+ L CF Sbjct: 118 LHWFAKYFPYLVLLHTLIFLACSNFWFKFPRTSSKLEHFVSILLKCF 164
>sp|Q8IWT6|LRRC8_HUMAN Leucine-rich repeat-containing protein 8 Length = 810 Score = 28.1 bits (61), Expect = 6.6 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -2 Query: 231 LHQFVKQHYHRVLMAS*CRLVANHFAHSYSYWHSYLQHFVANL*SCF 91 LH F K + VL+ + L ++F + S L+HFV+ L CF Sbjct: 118 LHWFAKYFPYLVLLHTLIFLACSNFWFKFPRTSSKLEHFVSILLKCF 164
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,588,595 Number of Sequences: 369166 Number of extensions: 271022 Number of successful extensions: 662 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 661 length of database: 68,354,980 effective HSP length: 49 effective length of database: 59,302,965 effective search space used: 1719785985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)