Planarian EST Database

Dr_sW_023_D10

BLASTX 2.2.12 [Aug-07-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Dr_sW_023_D10
         (205 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|O95625|ZBT11_HUMAN  Zinc finger and BTB domain containing...    29   3.0  

>sp|O95625|ZBT11_HUMAN Zinc finger and BTB domain containing protein 11
          Length = 1053

 Score = 29.3 bits (64), Expect = 3.0
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +1

Query: 1   LHQHNLSFTSSFNSSHQQ*QIICCIRSFVTRLSCFLH 111
           +++H L    S + S +Q Q   C++SFVT+ S   H
Sbjct: 689 IYKHGLKLHQSLHQSQKQFQCELCVKSFVTKRSLQEH 725

  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,734,695
Number of Sequences: 369166
Number of extensions: 130240
Number of successful extensions: 192
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 192
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 192
length of database: 68,354,980
effective HSP length: 39
effective length of database: 61,150,315
effective search space used: 1712208820
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)