Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_023_C22 (610 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P26308|GBB1_DROME Guanine nucleotide-binding protein bet... 45 1e-04 sp|P29387|GBB4_MOUSE Guanine nucleotide-binding protein bet... 44 3e-04 sp|Q61011|GBB3_MOUSE Guanine nucleotide-binding protein G(I... 44 3e-04 sp|O35353|GBB4_RAT Guanine nucleotide-binding protein beta ... 44 3e-04 sp|Q9HAV0|GBB4_HUMAN Guanine nucleotide-binding protein bet... 44 3e-04 sp|P52287|GBB3_RAT Guanine nucleotide-binding protein G(I)/... 44 3e-04 sp|P16520|GBB3_HUMAN Guanine nucleotide-binding protein G(I... 44 3e-04 sp|P54311|GBB1_RAT Guanine nucleotide-binding protein G(I)/... 44 3e-04 sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protein G(I... 44 3e-04 sp|P54313|GBB2_RAT Guanine nucleotide-binding protein G(I)/... 44 3e-04
>sp|P26308|GBB1_DROME Guanine nucleotide-binding protein beta subunit 1 Length = 340 Score = 45.4 bits (106), Expect = 1e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIW 92 HD RVSC+ V+ NG+ +ATGSWDS +W Sbjct: 311 HDNRVSCLGVTENGMAVATGSWDSFLRVW 339
Score = 30.4 bits (67), Expect = 3.7 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIWTSKPSQ 110 H+ ++ V+ PNG ATGS D++C ++ + Q Sbjct: 225 HESDINAVTFFPNGQAFATGSDDATCRLFDIRADQ 259
>sp|P29387|GBB4_MOUSE Guanine nucleotide-binding protein beta subunit 4 (Transducin beta chain 4) Length = 340 Score = 43.9 bits (102), Expect = 3e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIW 92 HD RVSC+ V+ +G+ +ATGSWDS IW Sbjct: 311 HDNRVSCLGVTDDGMAVATGSWDSFLRIW 339
>sp|Q61011|GBB3_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 3 (Transducin beta chain 3) Length = 340 Score = 43.9 bits (102), Expect = 3e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIW 92 HD RVSC+ V+ +G+ +ATGSWDS IW Sbjct: 311 HDNRVSCLGVTADGMAVATGSWDSFLKIW 339
Score = 30.4 bits (67), Expect = 3.7 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIWTSKPSQ 110 H+ ++ + PNG I TGS D+SC ++ + Q Sbjct: 225 HESDINAICFFPNGEAICTGSDDASCRLFDLRADQ 259
>sp|O35353|GBB4_RAT Guanine nucleotide-binding protein beta subunit 4 (Transducin beta chain 4) Length = 340 Score = 43.9 bits (102), Expect = 3e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIW 92 HD RVSC+ V+ +G+ +ATGSWDS IW Sbjct: 311 HDNRVSCLGVTDDGMAVATGSWDSFLRIW 339
>sp|Q9HAV0|GBB4_HUMAN Guanine nucleotide-binding protein beta subunit 4 (Transducin beta chain 4) Length = 340 Score = 43.9 bits (102), Expect = 3e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIW 92 HD RVSC+ V+ +G+ +ATGSWDS IW Sbjct: 311 HDNRVSCLGVTDDGMAVATGSWDSFLRIW 339
Score = 30.0 bits (66), Expect = 4.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIWTSKPSQ 110 H ++ VS PNG ATGS D++C ++ + Q Sbjct: 225 HVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQ 259
>sp|P52287|GBB3_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 3 (Transducin beta chain 3) Length = 340 Score = 43.9 bits (102), Expect = 3e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIW 92 HD RVSC+ V+ +G+ +ATGSWDS IW Sbjct: 311 HDNRVSCLGVTADGMAVATGSWDSFLKIW 339
Score = 30.4 bits (67), Expect = 3.7 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIWTSKPSQ 110 H+ ++ + PNG I TGS D+SC ++ + Q Sbjct: 225 HESDINAICFFPNGEAICTGSDDASCRLFDLRADQ 259
>sp|P16520|GBB3_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 3 (Transducin beta chain 3) Length = 340 Score = 43.9 bits (102), Expect = 3e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIW 92 HD RVSC+ V+ +G+ +ATGSWDS IW Sbjct: 311 HDNRVSCLGVTADGMAVATGSWDSFLKIW 339
Score = 30.4 bits (67), Expect = 3.7 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIWTSKPSQ 110 H+ ++ + PNG I TGS D+SC ++ + Q Sbjct: 225 HESDINAICFFPNGEAICTGSDDASCRLFDLRADQ 259
>sp|P54311|GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) sp|P62874|GBB1_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) sp|P62873|GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) sp|P62872|GBB1_CANFA Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) sp|P62871|GBB1_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) Length = 340 Score = 43.9 bits (102), Expect = 3e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIW 92 HD RVSC+ V+ +G+ +ATGSWDS IW Sbjct: 311 HDNRVSCLGVTDDGMAVATGSWDSFLKIW 339
>sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2 (Transducin beta chain 2) (G protein beta 2 subunit) Length = 326 Score = 43.9 bits (102), Expect = 3e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIW 92 HD RVSC+ V+ +G+ +ATGSWDS IW Sbjct: 297 HDNRVSCLGVTDDGMAVATGSWDSFLKIW 325
Score = 29.3 bits (64), Expect = 8.2 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIWTSKPSQ 110 H+ ++ V+ PNG TGS D++C ++ + Q Sbjct: 211 HESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQ 245
>sp|P54313|GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2 (Transducin beta chain 2) (G protein beta 2 subunit) sp|P62880|GBB2_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2 (Transducin beta chain 2) (G protein beta 2 subunit) sp|P62879|GBB2_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2 (Transducin beta chain 2) (G protein beta 2 subunit) Length = 340 Score = 43.9 bits (102), Expect = 3e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIW 92 HD RVSC+ V+ +G+ +ATGSWDS IW Sbjct: 311 HDNRVSCLGVTDDGMAVATGSWDSFLKIW 339
Score = 29.3 bits (64), Expect = 8.2 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 6 HDGRVSCVSVSPNGVGIATGSWDSSCLIWTSKPSQ 110 H+ ++ V+ PNG TGS D++C ++ + Q Sbjct: 225 HESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQ 259
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,827,365 Number of Sequences: 369166 Number of extensions: 990676 Number of successful extensions: 3226 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3223 length of database: 68,354,980 effective HSP length: 105 effective length of database: 48,957,805 effective search space used: 4748907085 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)