Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_023_B13 (498 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P05877|ENV_HV1MN Envelope polyprotein GP160 precursor [C... 32 0.83 sp|Q8F435|UVRA_LEPIN UvrABC system protein A (UvrA protein)... 29 5.4 sp|Q92502|STAR8_HUMAN StAR-related lipid transfer protein 8... 28 9.2
>sp|P05877|ENV_HV1MN Envelope polyprotein GP160 precursor [Contains: Exterior membrane glycoprotein (GP120); Transmembrane glycoprotein (GP41)] Length = 856 Score = 32.0 bits (71), Expect = 0.83 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +2 Query: 260 VDISWI*CSGYNYRDIYSCGCRFIEKLSRLFWNILRNWYIHDYIWS 397 VD+ + Y++RD+ R +E L R W +L+ W+ WS Sbjct: 759 VDLRSLFLFSYHHRDLLLIAARIVELLGRRGWEVLKYWWNLLQYWS 804
>sp|Q8F435|UVRA_LEPIN UvrABC system protein A (UvrA protein) (Excinuclease ABC subunit A) sp|Q72RM8|UVRA_LEPIC UvrABC system protein A (UvrA protein) (Excinuclease ABC subunit A) Length = 948 Score = 29.3 bits (64), Expect = 5.4 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -3 Query: 274 PADIDSHINAVIKKFLSGRLVK*KLDAPAAIR 179 PA++ H N++ K+LSGRL K+ PA +R Sbjct: 576 PAEVSKHKNSLTGKYLSGRL---KVPIPAKLR 604
>sp|Q92502|STAR8_HUMAN StAR-related lipid transfer protein 8 (StARD8) (START domain-containing protein 8) Length = 1023 Score = 28.5 bits (62), Expect = 9.2 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -3 Query: 172 PATNACQTPVTPIDIAIIPLITKKTPTAKNAIPKP 68 PAT++C++ +T + +P+IT P +P P Sbjct: 61 PATSSCESVLTELSATSLPVITVSLPPEPADLPLP 95
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,789,721 Number of Sequences: 369166 Number of extensions: 984355 Number of successful extensions: 2425 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2425 length of database: 68,354,980 effective HSP length: 102 effective length of database: 49,512,010 effective search space used: 3119256630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)