Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_022_P22 (492 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q16891|IMMT_HUMAN Mitochondrial inner membrane protein (... 30 4.0 sp|Q8CAQ8|IMMT_MOUSE Mitochondrial inner membrane protein (... 29 5.2 sp|Q9KF53|PUR9_BACHD Bifunctional purine biosynthesis prote... 29 5.2 sp|O02491|HMEN_ANOGA Segmentation polarity homeobox protein... 29 5.2 sp|Q8NDT2|RB15B_HUMAN Putative RNA-binding protein 15B (RNA... 29 6.8 sp|Q5YNA5|TRMB_NOCFA tRNA (guanine-N(7)-)-methyltransferase... 29 6.8 sp|Q7ZT98|CRVP_OPHHA Ophanin precursor (Opharin) 29 6.8
>sp|Q16891|IMMT_HUMAN Mitochondrial inner membrane protein (Mitofilin) (p87/89) (Proliferation-inducing gene 4 protein) Length = 758 Score = 29.6 bits (65), Expect = 4.0 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -1 Query: 375 HHQAIISVENENRIRSERDSTKNE--EELQPMAVALVEHSVDVV 250 HH++ I E + +I RD+ +NE +L+ A A +H DV+ Sbjct: 455 HHRSEIQAEQDRKIEEVRDAMENEMRTQLRRQAAAHTDHLRDVL 498
>sp|Q8CAQ8|IMMT_MOUSE Mitochondrial inner membrane protein (Mitofilin) Length = 757 Score = 29.3 bits (64), Expect = 5.2 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -1 Query: 375 HHQAIISVENENRIRSERDSTKNE--EELQPMAVALVEHSVDVV 250 HH++ I E + ++ RD+ +NE +L+ A A +H DV+ Sbjct: 454 HHRSEIQAEQDRKVEEVRDAMENEMRTQLRRQAAAHTDHLRDVL 497
>sp|Q9KF53|PUR9_BACHD Bifunctional purine biosynthesis protein purH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (AICAR transformylase); IMP cyclohydrolase (Inosinicase) (IMP synthetase) (ATIC)] Length = 511 Score = 29.3 bits (64), Expect = 5.2 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 318 STKNEEELQPMAVALVEHSVDVVGQALVGSALVE 217 S N+E + P A ALVEH V++V AL E Sbjct: 8 SVSNKEGIVPFAKALVEHEVEIVSTGGTKRALQE 41
>sp|O02491|HMEN_ANOGA Segmentation polarity homeobox protein engrailed Length = 596 Score = 29.3 bits (64), Expect = 5.2 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 67 HHNLPHHTMPLHKHKQRQLPS 129 HH LPHH P H+H +Q PS Sbjct: 100 HHQLPHH--PHHQHHPQQQPS 118
>sp|Q8NDT2|RB15B_HUMAN Putative RNA-binding protein 15B (RNA-binding motif protein 15B) Length = 563 Score = 28.9 bits (63), Expect = 6.8 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 390 GYYHYHHQAIISVENENRIRSERDSTKNEEELQPM 286 G++H+HH+A S + SER+ E E +P+ Sbjct: 337 GHHHHHHEAADSSHGKKARDSERNHRTTEAEPKPL 371
>sp|Q5YNA5|TRMB_NOCFA tRNA (guanine-N(7)-)-methyltransferase (tRNA(m7G46)-methyltransferase) Length = 269 Score = 28.9 bits (63), Expect = 6.8 Identities = 21/61 (34%), Positives = 28/61 (45%) Frame = -1 Query: 333 RSERDSTKNEEELQPMAVALVEHSVDVVGQALVGSALVEPIVAAEHSE*RQLVAATVAIA 154 R ERD N L+ AV ++EH + V +P A H + R L ATVA+ Sbjct: 128 RIERDGIDNIRLLRGDAVDVLEHMIAAESLTGVRVFFPDPWPKARHHKRRLLQPATVALI 187 Query: 153 A 151 A Sbjct: 188 A 188
>sp|Q7ZT98|CRVP_OPHHA Ophanin precursor (Opharin) Length = 239 Score = 28.9 bits (63), Expect = 6.8 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 14 ATSSTRWSS-CNYGSCPDYTTTYRIIQC 94 A+++ RW+S CN G PDY+ I+C Sbjct: 64 ASNAERWASNCNLGHSPDYSRVLEGIEC 91
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,140,959 Number of Sequences: 369166 Number of extensions: 736761 Number of successful extensions: 2899 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2892 length of database: 68,354,980 effective HSP length: 102 effective length of database: 49,512,010 effective search space used: 3020232610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)