Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_022_P21 (186 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P51572|BAP31_HUMAN B-cell receptor-associated protein 31... 59 3e-09 sp|Q5R8H3|BAP31_PONPY B-cell receptor-associated protein 31... 58 6e-09 sp|Q61335|BAP31_MOUSE B-cell receptor-associated protein 31... 55 6e-08 sp|Q61334|BAP29_MOUSE B-cell receptor-associated protein 29... 45 7e-05 sp|Q9UHQ4|BAP29_HUMAN B-cell receptor-associated protein 29... 44 9e-05 sp|Q5R9U7|BAP29_PONPY B-cell receptor-associated protein 29... 44 9e-05
>sp|P51572|BAP31_HUMAN B-cell receptor-associated protein 31 (BCR-associated protein Bap31) (p28 Bap31) (CDM protein) (6C6-AG tumor-associated antigen) (DXS1357E) Length = 246 Score = 59.3 bits (142), Expect = 3e-09 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +2 Query: 53 MSLQWVAIAGFLYLEMFIALLFAIPFISASRGSKIFKSRIIKTL 184 MSLQW A+A FLY E+F+ LL IPFIS R KIFKSR+++ L Sbjct: 1 MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELL 44
>sp|Q5R8H3|BAP31_PONPY B-cell receptor-associated protein 31 (BCR-associated protein Bap31) Length = 246 Score = 58.2 bits (139), Expect = 6e-09 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +2 Query: 53 MSLQWVAIAGFLYLEMFIALLFAIPFISASRGSKIFKSRIIK 178 MSLQW A+A FLY E+F+ LL IPFIS R KIFKSR+++ Sbjct: 1 MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVE 42
>sp|Q61335|BAP31_MOUSE B-cell receptor-associated protein 31 (BCR-associated protein Bap31) (p28 Bap31) Length = 245 Score = 54.7 bits (130), Expect = 6e-08 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = +2 Query: 53 MSLQWVAIAGFLYLEMFIALLFAIPFISASRGSKIFKSRIIK 178 MSLQW +A FLY E+F LL IPFIS R K+FKSR+++ Sbjct: 1 MSLQWTTVATFLYAEVFAVLLLCIPFISPKRWQKVFKSRLVE 42
>sp|Q61334|BAP29_MOUSE B-cell receptor-associated protein 29 (BCR-associated protein Bap29) Length = 240 Score = 44.7 bits (104), Expect = 7e-05 Identities = 19/36 (52%), Positives = 25/36 (69%) Frame = +2 Query: 53 MSLQWVAIAGFLYLEMFIALLFAIPFISASRGSKIF 160 M++QW A+A FLY E+ + LLF +PFI R KIF Sbjct: 1 MTIQWAAVASFLYAEIGLILLFCLPFIPPQRWQKIF 36
>sp|Q9UHQ4|BAP29_HUMAN B-cell receptor-associated protein 29 (BCR-associated protein Bap29) Length = 241 Score = 44.3 bits (103), Expect = 9e-05 Identities = 19/40 (47%), Positives = 26/40 (65%) Frame = +2 Query: 53 MSLQWVAIAGFLYLEMFIALLFAIPFISASRGSKIFKSRI 172 M+LQW A+A FLY E+ + L+F +PFI R KIF + Sbjct: 1 MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNV 40
>sp|Q5R9U7|BAP29_PONPY B-cell receptor-associated protein 29 (BCR-associated protein Bap29) Length = 241 Score = 44.3 bits (103), Expect = 9e-05 Identities = 19/40 (47%), Positives = 26/40 (65%) Frame = +2 Query: 53 MSLQWVAIAGFLYLEMFIALLFAIPFISASRGSKIFKSRI 172 M+LQW A+A FLY E+ + L+F +PFI R KIF + Sbjct: 1 MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNV 40
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,984,608 Number of Sequences: 369166 Number of extensions: 191231 Number of successful extensions: 374 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 373 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 374 length of database: 68,354,980 effective HSP length: 34 effective length of database: 62,073,990 effective search space used: 1675997730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)