Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_022_N14 (292 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P55202|ANPRB_ANGJA Atrial natriuretic peptide receptor B... 30 1.7 sp|Q7NDF7|RPOC2_GLOVI DNA-directed RNA polymerase beta' cha... 28 6.5 sp|Q56559|UREE_UREPA Urease accessory protein ureE 28 8.5
>sp|P55202|ANPRB_ANGJA Atrial natriuretic peptide receptor B precursor (ANP-B) (ANPRB) (GC-B) (Guanylate cyclase) (NPR-B) (Atrial natriuretic peptide B-type receptor) Length = 1050 Score = 30.0 bits (66), Expect = 1.7 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 180 HFLHQLHFHWTLNYFLVLHDL 118 H+LH HF+WT F++ HDL Sbjct: 162 HYLHS-HFNWTTRAFMLFHDL 181
>sp|Q7NDF7|RPOC2_GLOVI DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1262 Score = 28.1 bits (61), Expect = 6.5 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +1 Query: 70 VDLLEVEADQDLEAGVEVVED 132 + LLEVE Q +EAGV+VV+D Sbjct: 643 ISLLEVEDGQYVEAGVQVVKD 663
>sp|Q56559|UREE_UREPA Urease accessory protein ureE Length = 149 Score = 27.7 bits (60), Expect = 8.5 Identities = 11/42 (26%), Positives = 28/42 (66%) Frame = +1 Query: 19 LEMRQLDLMAMTMTCLVVDLLEVEADQDLEAGVEVVEDKKII 144 +E Q++ + +T ++ ++ + +DQ++E G+ + EDKK++ Sbjct: 17 VESYQIENIHLTSDDVLKRVIIISSDQNVEYGIRLEEDKKLM 58
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,642,877 Number of Sequences: 369166 Number of extensions: 281396 Number of successful extensions: 705 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 705 length of database: 68,354,980 effective HSP length: 66 effective length of database: 56,162,470 effective search space used: 1684874100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)