Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_022_K15 (171 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P15397|ROLT_AGRRH Protein rolB(TR) 28 5.0 sp|Q5WN23|GCP2_CAEBR Glutamate carboxypeptidase II homolog 28 8.5
>sp|P15397|ROLT_AGRRH Protein rolB(TR) Length = 274 Score = 28.5 bits (62), Expect = 5.0 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +3 Query: 45 SQSLRKKAVRFQRVIVESKMFLAELHHPANHTRHLNQKIIT 167 +QS R + +RFQ+ E + + E +P N + +N +I+T Sbjct: 51 NQSFRGEIMRFQKAFAERVLNMVEARYPVNQLK-INAEILT 90
>sp|Q5WN23|GCP2_CAEBR Glutamate carboxypeptidase II homolog Length = 770 Score = 27.7 bits (60), Expect = 8.5 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +3 Query: 15 RIQIALLSPESQSLRKKAVRFQRVIVESKMFLAELHHPANHTRHLNQKIIT 167 R Q ALLS SQ L + +FQ + + ++ + A H +N+++I+ Sbjct: 640 RTQYALLSKSSQDLLVMSKKFQETMQFTFHSFSQNPYDAKHVNAVNERLIS 690
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,747,383 Number of Sequences: 369166 Number of extensions: 135816 Number of successful extensions: 415 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 415 length of database: 68,354,980 effective HSP length: 29 effective length of database: 62,997,665 effective search space used: 1700936955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)