Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_022_I23 (444 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q7VKH9|RL31B_HAEDU 50S ribosomal protein L31 type B 33 0.37 sp|Q92359|YDHE_SCHPO Hypothetical protein C6G9.14 in chromo... 30 3.1 sp|O88576|S6A18_MOUSE Sodium- and chloride-dependent transp... 30 3.1 sp|Q03096|EST3_YEAST Telomere replication protein EST3 (Eve... 30 3.1 sp|P31677|OTSA_ECOLI Alpha,alpha-trehalose-phosphate syntha... 29 4.0 sp|Q8XCE7|OTSA_ECO57 Alpha,alpha-trehalose-phosphate syntha... 29 4.0 sp|Q13075|BIR1_HUMAN Baculoviral IAP repeat-containing prot... 29 5.3 sp|Q9P6S0|YJP1_SCHPO Hypothetical threonine-rich protein C1... 28 6.9 sp|P74178|Y1178_SYNY3 Hypothetical protein sll1178 28 9.0 sp|Q6YR87|TILS_ONYPE tRNA(Ile)-lysidine synthase (tRNA(Ile)... 28 9.0
>sp|Q7VKH9|RL31B_HAEDU 50S ribosomal protein L31 type B Length = 89 Score = 32.7 bits (73), Expect = 0.37 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -2 Query: 335 YSCSSNVQWFIRACVSSNNSIMW 267 Y S+ + W IR+CV++N S+MW Sbjct: 16 YDASAQMGWVIRSCVATNKSMMW 38
>sp|Q92359|YDHE_SCHPO Hypothetical protein C6G9.14 in chromosome I Length = 681 Score = 29.6 bits (65), Expect = 3.1 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = -1 Query: 375 LCEDATFQRTYHHLLLLEQRTVVHKSLCVLQQQHYVVLPHSPSIARHIHFPKHVLQY 205 +CED T+ H + QR H S ++Q ++PH+ ++ + F +VLQY Sbjct: 489 ICEDPLDVSTHRHGCCVVQRCFDHASPAQIEQLVEHIVPHALTLVQDA-FGNYVLQY 544
>sp|O88576|S6A18_MOUSE Sodium- and chloride-dependent transporter XTRP2 (Solute carrier family 6 member 18) Length = 615 Score = 29.6 bits (65), Expect = 3.1 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -2 Query: 245 LPDIFISPNTYSSITKYLILTNIIFFASIRKKSCGMSDF 129 LP++ IS + Y S+ YL T A + K+C + DF Sbjct: 335 LPELSISRDEYPSVLMYLNATQTARVAQLPLKTCHLEDF 373
>sp|Q03096|EST3_YEAST Telomere replication protein EST3 (Ever shorter telomeres protein 3) [Contains: Telomere replication protein EST3 short protein] Length = 181 Score = 29.6 bits (65), Expect = 3.1 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 10/64 (15%) Frame = -2 Query: 257 IPHPLPDIFISPNTYSSITKYLILTNIIFFASIRKKS----CGMSDFCFS------NCNI 108 +PH P I +P ++ ITK+ + + +ASIR S S C S NC I Sbjct: 52 LPHMSPTILTNPCHFAKITKFYNVCDYKVYASIRDSSHQILVEFSQECVSNFERTHNCRI 111 Query: 107 TTSS 96 T+ + Sbjct: 112 TSET 115
>sp|P31677|OTSA_ECOLI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] (Trehalose-6-phosphate synthase) (UDP-glucose-glucosephosphate glucosyltransferase) Length = 474 Score = 29.3 bits (64), Expect = 4.0 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = -2 Query: 284 NNSIMWYCPIPHPLPDIFISPNTYSSITKYLILTNIIFFASIRKKSCGMSDFCFSN-CNI 108 NN I ++ IP P P+IF + TY ++ + L +++ F + + + C SN + Sbjct: 147 NNRIGFFLHIPFPTPEIFNALPTYDTLLEQLCDYDLLGFQTENDRLAFLD--CLSNLTRV 204 Query: 107 TTSS 96 TT S Sbjct: 205 TTRS 208
>sp|Q8XCE7|OTSA_ECO57 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] (Trehalose-6-phosphate synthase) (UDP-glucose-glucosephosphate glucosyltransferase) Length = 474 Score = 29.3 bits (64), Expect = 4.0 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = -2 Query: 284 NNSIMWYCPIPHPLPDIFISPNTYSSITKYLILTNIIFFASIRKKSCGMSDFCFSN-CNI 108 NN I ++ IP P P+IF + TY ++ + L +++ F + + + C SN + Sbjct: 147 NNRIGFFLHIPFPTPEIFNALPTYDTLLEQLCDYDLLGFQTENDRLAFLD--CLSNLTRV 204 Query: 107 TTSS 96 TT S Sbjct: 205 TTRS 208
>sp|Q13075|BIR1_HUMAN Baculoviral IAP repeat-containing protein 1 (Neuronal apoptosis inhibitory protein) Length = 1403 Score = 28.9 bits (63), Expect = 5.3 Identities = 20/71 (28%), Positives = 27/71 (38%), Gaps = 19/71 (26%) Frame = -1 Query: 378 QLCEDATFQRTYHHLLLLEQRTVVHK-------------------SLCVLQQQHYVVLPH 256 Q+C A F HLL+L +T +L L Q++ P Sbjct: 849 QICPQAYFSMVSEHLLVLALKTAYQSNTVAACSPFVLQFLQGRTLTLGALNLQYFFDHPE 908 Query: 255 SPSIARHIHFP 223 S S+ R IHFP Sbjct: 909 SLSLLRSIHFP 919
>sp|Q9P6S0|YJP1_SCHPO Hypothetical threonine-rich protein C1742.01 in chromosome III precursor Length = 1563 Score = 28.5 bits (62), Expect = 6.9 Identities = 19/54 (35%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = -3 Query: 352 THISPLTLARATYSGS*ELVC-PPTTALCGTAPFPIHCQTYSFPQTRTPVSQST 194 T +P T+ T SGS C PPTT L T P T +P + T T Sbjct: 168 TSCNPATVLIVTTSGSTSTSCPPPTTILIVTVPTTTTTTTVGYPGSVTTTLTGT 221
>sp|P74178|Y1178_SYNY3 Hypothetical protein sll1178 Length = 615 Score = 28.1 bits (61), Expect = 9.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 195 VLCDTGVRVWGNEYVWQWMGNGAVPH 272 VLC GV W +W GN PH Sbjct: 152 VLCMDGVGEWATTSLWSGQGNQLTPH 177
>sp|Q6YR87|TILS_ONYPE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 436 Score = 28.1 bits (61), Expect = 9.0 Identities = 12/46 (26%), Positives = 27/46 (58%) Frame = -1 Query: 336 LLLLEQRTVVHKSLCVLQQQHYVVLPHSPSIARHIHFPKHVLQYHK 199 LLLLEQ+ + + + + P+ P+++ H++F H+++ +K Sbjct: 258 LLLLEQQNITKSFIFIQNIIKGINNPYKPNLSWHLNFEWHLIKDYK 303
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,200,333 Number of Sequences: 369166 Number of extensions: 1316923 Number of successful extensions: 3389 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3383 length of database: 68,354,980 effective HSP length: 100 effective length of database: 49,881,480 effective search space used: 2344429560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)