Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_022_H11 (533 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q7VKH9|RL31B_HAEDU 50S ribosomal protein L31 type B 33 0.57 sp|P31677|OTSA_ECOLI Alpha,alpha-trehalose-phosphate syntha... 29 6.3 sp|Q8XCE7|OTSA_ECO57 Alpha,alpha-trehalose-phosphate syntha... 29 6.3 sp|Q9P6S0|YJP1_SCHPO Hypothetical threonine-rich protein C1... 29 6.3 sp|P58955|GR36A_DROME Putative gustatory receptor 36a 29 8.2 sp|Q03096|EST3_YEAST Telomere replication protein EST3 (Eve... 29 8.2
>sp|Q7VKH9|RL31B_HAEDU 50S ribosomal protein L31 type B Length = 89 Score = 32.7 bits (73), Expect = 0.57 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -3 Query: 366 YSCSSNVQWFIRACVSSNNSIMW 298 Y S+ + W IR+CV++N S+MW Sbjct: 16 YDASAQMGWVIRSCVATNKSMMW 38
>sp|P31677|OTSA_ECOLI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] (Trehalose-6-phosphate synthase) (UDP-glucose-glucosephosphate glucosyltransferase) Length = 474 Score = 29.3 bits (64), Expect = 6.3 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = -3 Query: 315 NNSIMWYCPIPHPLPDIFISPNTYSSITKYLILRNIIFFASIRKKSCGMSDFCFSN-CNI 139 NN I ++ IP P P+IF + TY ++ + L +++ F + + + C SN + Sbjct: 147 NNRIGFFLHIPFPTPEIFNALPTYDTLLEQLCDYDLLGFQTENDRLAFLD--CLSNLTRV 204 Query: 138 TTSS 127 TT S Sbjct: 205 TTRS 208
>sp|Q8XCE7|OTSA_ECO57 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] (Trehalose-6-phosphate synthase) (UDP-glucose-glucosephosphate glucosyltransferase) Length = 474 Score = 29.3 bits (64), Expect = 6.3 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = -3 Query: 315 NNSIMWYCPIPHPLPDIFISPNTYSSITKYLILRNIIFFASIRKKSCGMSDFCFSN-CNI 139 NN I ++ IP P P+IF + TY ++ + L +++ F + + + C SN + Sbjct: 147 NNRIGFFLHIPFPTPEIFNALPTYDTLLEQLCDYDLLGFQTENDRLAFLD--CLSNLTRV 204 Query: 138 TTSS 127 TT S Sbjct: 205 TTRS 208
>sp|Q9P6S0|YJP1_SCHPO Hypothetical threonine-rich protein C1742.01 in chromosome III precursor Length = 1563 Score = 29.3 bits (64), Expect = 6.3 Identities = 20/57 (35%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = -1 Query: 392 TFPTHISPLTLARATYSGS*ELVC-PPTTALCGTAPFPIHCQTYSFPQTRTPVSQST 225 T T +P T+ T SGS C PPTT L T P T +P + T T Sbjct: 165 TTSTSCNPATVLIVTTSGSTSTSCPPPTTILIVTVPTTTTTTTVGYPGSVTTTLTGT 221
>sp|P58955|GR36A_DROME Putative gustatory receptor 36a Length = 391 Score = 28.9 bits (63), Expect = 8.2 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = -2 Query: 427 HMA*MHNYVKMLLFQRTYHHLLLLEQRTVVHKS 329 +MA +Y+ ++LF R Y+HLL E R +H+S Sbjct: 173 NMAISQHYL-VILFVRAYYHLLKTEVRQAIHES 204
>sp|Q03096|EST3_YEAST Telomere replication protein EST3 (Ever shorter telomeres protein 3) [Contains: Telomere replication protein EST3 short protein] Length = 181 Score = 28.9 bits (63), Expect = 8.2 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 10/64 (15%) Frame = -3 Query: 288 IPHPLPDIFISPNTYSSITKYLILRNIIFFASIRKKS----CGMSDFCFS------NCNI 139 +PH P I +P ++ ITK+ + + +ASIR S S C S NC I Sbjct: 52 LPHMSPTILTNPCHFAKITKFYNVCDYKVYASIRDSSHQILVEFSQECVSNFERTHNCRI 111 Query: 138 TTSS 127 T+ + Sbjct: 112 TSET 115
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.317 0.135 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,607,964 Number of Sequences: 369166 Number of extensions: 1560222 Number of successful extensions: 4068 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3931 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4061 length of database: 68,354,980 effective HSP length: 103 effective length of database: 49,327,275 effective search space used: 3650218350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)