Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_022_H09 (633 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8SPU6|ACHB4_BOVIN Neuronal acetylcholine receptor prote... 31 3.0 sp|Q6LA06|MATK_TYPLA Maturase K (Intron maturase) 30 6.7
>sp|Q8SPU6|ACHB4_BOVIN Neuronal acetylcholine receptor protein, beta-4 subunit precursor Length = 496 Score = 30.8 bits (68), Expect = 3.0 Identities = 13/42 (30%), Positives = 27/42 (64%) Frame = -2 Query: 359 IRKFWSNYILIINVSRHKWNINVILIHNNRLWI*GVTWINNS 234 +++ W++Y L N SR++ +N++ I NR+W+ + NN+ Sbjct: 81 LKQEWTDYRLAWNSSRYE-GVNILRIPANRVWLPDIVLYNNA 121
>sp|Q6LA06|MATK_TYPLA Maturase K (Intron maturase) Length = 513 Score = 29.6 bits (65), Expect = 6.7 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = -2 Query: 386 SNIIVRRWIIRKFWSNYILIINVSRHKWNINVILIHNN 273 S+++V+R IIR + NY +IN + H N N L HNN Sbjct: 58 SSVLVKRLIIRMYQQNY--LINSTNHS-NQNRFLGHNN 92
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,591,669 Number of Sequences: 369166 Number of extensions: 1132276 Number of successful extensions: 2727 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2727 length of database: 68,354,980 effective HSP length: 106 effective length of database: 48,773,070 effective search space used: 5072399280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)