Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_022_F15 (394 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P42724|TFXB_RHILT Trifolitoxin processing protein tfxB 30 1.7 sp|O33815|BGAL_STAXY Beta-galactosidase (Lactase) 30 2.3 sp|Q90WJ8|AJL2_ANGJA Lactose-binding lectin l-2 precursor (... 29 3.9 sp|P54145|AMT1_CAEEL Putative ammonium transporter 1 28 5.1
>sp|P42724|TFXB_RHILT Trifolitoxin processing protein tfxB Length = 373 Score = 30.0 bits (66), Expect = 1.7 Identities = 20/67 (29%), Positives = 29/67 (43%) Frame = +3 Query: 120 WADGENVPKGAVVGGINDGQPLYVARSNVGGQVVVGKYFPQHGCGYFPYGGEEHRVDSVE 299 +A GE++ K GG AR + VVVG G + Y HR+D++E Sbjct: 213 YATGEHLRKAVPSGG---------ARHPIEFYVVVGDEIAGIEAGVYHYNVRHHRLDAIE 263 Query: 300 VLCCSTK 320 + S K Sbjct: 264 IASTSLK 270
>sp|O33815|BGAL_STAXY Beta-galactosidase (Lactase) Length = 994 Score = 29.6 bits (65), Expect = 2.3 Identities = 25/92 (27%), Positives = 39/92 (42%), Gaps = 8/92 (8%) Frame = +3 Query: 33 AYGGAEHSKNYYEVLVESSILSHKGYEWRWADGENVPKGAVVGGINDGQPLYVARSNVGG 212 A G + + Y+ LVE G+ W W D A+ G+ DG P++ + G Sbjct: 514 AMGNSPGDLHAYQTLVEQYDSFIGGFVWEWCD------HAIQTGMKDGNPIFRYGGDFGE 567 Query: 213 QV------VVGKYFPQH--GCGYFPYGGEEHR 284 ++ V G FP GY+ + +EHR Sbjct: 568 KLHDGNFCVDGIVFPNRVPHEGYYEF-KQEHR 598
>sp|Q90WJ8|AJL2_ANGJA Lactose-binding lectin l-2 precursor (Ajl-2) Length = 166 Score = 28.9 bits (63), Expect = 3.9 Identities = 16/61 (26%), Positives = 26/61 (42%) Frame = +3 Query: 99 HKGYEWRWADGENVPKGAVVGGINDGQPLYVARSNVGGQVVVGKYFPQHGCGYFPYGGEE 278 H+G W W+DG + N G+P ++ GG + C + YGG++ Sbjct: 100 HEGRSWLWSDGTSASAEGDFSMWNPGEP-----NDAGG---------KEDCVHDNYGGQK 145 Query: 279 H 281 H Sbjct: 146 H 146
>sp|P54145|AMT1_CAEEL Putative ammonium transporter 1 Length = 534 Score = 28.5 bits (62), Expect = 5.1 Identities = 20/59 (33%), Positives = 29/59 (49%) Frame = +3 Query: 45 AEHSKNYYEVLVESSILSHKGYEWRWADGENVPKGAVVGGINDGQPLYVARSNVGGQVV 221 A H+ + L+ SSI+SH G + AD AV G N G L A + +G Q++ Sbjct: 350 AVHAGGGFWGLMSSSIISHGGVAYALAD-------AVSGAKNSGDHLTQAFAQLGWQMI 401
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,863,240 Number of Sequences: 369166 Number of extensions: 992631 Number of successful extensions: 2974 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2969 length of database: 68,354,980 effective HSP length: 96 effective length of database: 50,620,420 effective search space used: 1721094280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)