Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_022_D18 (322 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q12116|TMS1_YEAST Membrane protein TMS1 29 2.9 sp|O59751|KLP6_SCHPO Kinesin-like protein 6 28 5.0
>sp|Q12116|TMS1_YEAST Membrane protein TMS1 Length = 473 Score = 29.3 bits (64), Expect = 2.9 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = -3 Query: 224 GYYVFHRYHYLL*CATTVTSLVFIIDRSTEDSTCATKNTGACTIFDLLLLAVV 66 G++ HR ++ L C + +LV +ST D A +N+ F L L +V Sbjct: 81 GFFTVHRLNFALGCLHLILALVLTGVKSTNDVRAALQNSWWSLKFILYLCLIV 133
>sp|O59751|KLP6_SCHPO Kinesin-like protein 6 Length = 784 Score = 28.5 bits (62), Expect = 5.0 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -3 Query: 134 DSTCATKNTGACTIFDLLLLAVVRFCTNGMRKYHRIVDD 18 D + A NT + T FCTNG+RK R++DD Sbjct: 36 DGSLAVSNTSSNT-----------FCTNGIRKIVRVLDD 63
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,030,143 Number of Sequences: 369166 Number of extensions: 535029 Number of successful extensions: 1174 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1174 length of database: 68,354,980 effective HSP length: 75 effective length of database: 54,499,855 effective search space used: 1689495505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)