Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_021_O04 (763 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P40492|YIJ7_YEAST Hypothetical 59.9 kDa protein in SGA1-... 42 0.002 sp|Q96G75|U2508_HUMAN Protein UNQ2508/PRO5996 32 1.4 sp|Q91YQ7|U2508_MOUSE Protein UNQ2508/PRO5996 homolog 32 1.9 sp|P22611|VMT8_MYXVL Kelch repeat protein M-T8 31 3.2 sp|Q96TP5|ACEA_COCIM Isocitrate lyase (Isocitrase) (Isocitr... 31 3.2 sp|Q86ZF1|ACEA_LEPMC Isocitrate lyase (Isocitrase) (Isocitr... 30 5.4 sp|P29551|EF3_PNECA Elongation factor 3 (EF-3) 30 7.1 sp|Q12508|RMD5_YEAST Sporulation protein RMD5 (Glucose-indu... 30 9.3 sp|Q9PL60|Y248_CHLMU Hypothetical protein TC0248 30 9.3
>sp|P40492|YIJ7_YEAST Hypothetical 59.9 kDa protein in SGA1-KTR7 intergenic region Length = 516 Score = 42.0 bits (97), Expect = 0.002 Identities = 40/166 (24%), Positives = 57/166 (34%), Gaps = 48/166 (28%) Frame = +2 Query: 308 DEDWIVQRFHSFILQFYSFY--HEPSVMSLMIKTGIAVRKTENCYKPE------------ 445 D+ W V F+ FYS Y + + + + GI+ KT +C P Sbjct: 353 DQRWSVLN-DLFLSDFYSMYGISQNDPLLIYLSLGISSLKTRDCLHPSDDENGNQETETA 411 Query: 446 -----------------MKRKECVVCIDRVNKISVDIPAARHDHSILICWKTGLEMNEDN 574 +KRK C VC + I+ +P A H S L Sbjct: 412 TTAEKEVEDLQLFTLHSLKRKNCPVCSETFKPITQALPFAHHIQSQLF-----------E 460 Query: 575 PPIAFPNGYVYSTKAIPEL-----------------IDPTDNKVVC 661 PI PNG VY +K + +L +DP D K+ C Sbjct: 461 NPILLPNGNVYDSKKLKKLAKTLKKQNLISLNPGQIMDPVDMKIFC 506
>sp|Q96G75|U2508_HUMAN Protein UNQ2508/PRO5996 Length = 393 Score = 32.3 bits (72), Expect = 1.4 Identities = 23/106 (21%), Positives = 50/106 (47%), Gaps = 10/106 (9%) Frame = +2 Query: 377 SVMSLMIKTGIAVRKTENCY--------KPEMKRKECVVCIDRVNKISVDIPAARHD--H 526 S++ L +++ ++V C K +++++C + +++ ++I H Sbjct: 274 SLLGLSVESPLSVSFASGCVALPVLMNIKAVIEQRQCTGVWNHKDELPIEIELGMKCWYH 333 Query: 527 SILICWKTGLEMNEDNPPIAFPNGYVYSTKAIPELIDPTDNKVVCP 664 S+ C + ++ NPPI G+V S A+ +LI+ K+ CP Sbjct: 334 SVFACPILRQQTSDSNPPIKLICGHVISRDALNKLIN--GGKLKCP 377
>sp|Q91YQ7|U2508_MOUSE Protein UNQ2508/PRO5996 homolog Length = 393 Score = 32.0 bits (71), Expect = 1.9 Identities = 23/106 (21%), Positives = 49/106 (46%), Gaps = 10/106 (9%) Frame = +2 Query: 377 SVMSLMIKTGIAVRKTENCY--------KPEMKRKECVVCIDRVNKISVDIPAARHD--H 526 S++ L +++ ++V C K +++++C +++ ++I H Sbjct: 274 SLLGLSVESPLSVSFASGCVALPVLMNIKAVIEQRQCTGVWSHKDELPIEIELGMKCWYH 333 Query: 527 SILICWKTGLEMNEDNPPIAFPNGYVYSTKAIPELIDPTDNKVVCP 664 S+ C + ++ NPPI G+V S A+ +LI+ K+ CP Sbjct: 334 SVFACPILRQQTSDSNPPIKLICGHVISRDALNKLIN--GGKLKCP 377
>sp|P22611|VMT8_MYXVL Kelch repeat protein M-T8 Length = 515 Score = 31.2 bits (69), Expect = 3.2 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -1 Query: 208 HLRVAKRMSK-FYSLFPITFFYQQIELEDLQITFKCVFDVSLFIF 77 H V SK FY+LF F + +++ DL+ +K VFDV +++ Sbjct: 30 HRLVLSAYSKYFYNLFNGNFLEKNVDVIDLEADYKTVFDVIYYMY 74
>sp|Q96TP5|ACEA_COCIM Isocitrate lyase (Isocitrase) (Isocitratase) (ICL) Length = 538 Score = 31.2 bits (69), Expect = 3.2 Identities = 17/69 (24%), Positives = 35/69 (50%), Gaps = 12/69 (17%) Frame = +2 Query: 47 VEQWLQSIQFKY------------KKGDVKNTFESDLQIFKLYLLIKEGDWEQAIKFAHS 190 V+QW + +++Y K+G++K + S++Q KL+ L++E + F + Sbjct: 19 VKQWWKDSRWRYTKRPFTAEQIVAKRGNLKIEYPSNVQSKKLWKLVEEKFKTKTASFTYG 78 Query: 191 FCDPKMIKE 217 DP M+ + Sbjct: 79 CLDPTMVTQ 87
>sp|Q86ZF1|ACEA_LEPMC Isocitrate lyase (Isocitrase) (Isocitratase) (ICL) Length = 537 Score = 30.4 bits (67), Expect = 5.4 Identities = 18/83 (21%), Positives = 39/83 (46%), Gaps = 12/83 (14%) Frame = +2 Query: 5 LDIVEALKQGNFHPVEQWLQSIQFKY------------KKGDVKNTFESDLQIFKLYLLI 148 +D +A Q V+QW +++Y K+G++K T+ S+ Q KL+ ++ Sbjct: 4 MDAEDAQFQKEVAEVKQWWNDSRWRYTKRTFTAEEIVSKRGNLKITYPSNSQSKKLWNIV 63 Query: 149 KEGDWEQAIKFAHSFCDPKMIKE 217 + + + + + DP M+ + Sbjct: 64 EHRFKNKDVSYTYGCLDPVMVTQ 86
>sp|P29551|EF3_PNECA Elongation factor 3 (EF-3) Length = 1042 Score = 30.0 bits (66), Expect = 7.1 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 4/53 (7%) Frame = -1 Query: 256 HQSHNLAQLIHRVL-FDHLRVAK---RMSKFYSLFPITFFYQQIELEDLQITF 110 H S L ++ ++ ++H ++ K MSKF +L P YQ I + +++ +F Sbjct: 599 HDSKFLDNVVQAIIHYEHFKLKKYMGNMSKFITLVPSARSYQDISMSEIEFSF 651
>sp|Q12508|RMD5_YEAST Sporulation protein RMD5 (Glucose-induced degradation protein 2) Length = 421 Score = 29.6 bits (65), Expect = 9.3 Identities = 19/66 (28%), Positives = 25/66 (37%) Frame = +2 Query: 518 HDHSILICWKTGLEMNEDNPPIAFPNGYVYSTKAIPELIDPTDNKVVCPRSKCRCKESEL 697 H H I IC E +NPP + ++ S KA+ L CP S Sbjct: 354 HFHPIFICPVLKEETTTENPPYSLACHHIISKKALDRLSKNGTITFKCPYCPVNTSMSST 413 Query: 698 QKVYIV 715 +KV V Sbjct: 414 KKVRFV 419
>sp|Q9PL60|Y248_CHLMU Hypothetical protein TC0248 Length = 601 Score = 29.6 bits (65), Expect = 9.3 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 9/66 (13%) Frame = +2 Query: 476 DRVNKISVDIPAARH----DHSILICWKTG-LEMNEDNPPIAF----PNGYVYSTKAIPE 628 D + +D+ AA + H +L CWK G +E++ P F P+ V TK I Sbjct: 424 DNMEGYPIDLQAAEYLKSFAHQVLACWKNGDIELSTPIPLFGFEKIHPHPRVQYTKPICV 483 Query: 629 LIDPTD 646 LI+ D Sbjct: 484 LINEQD 489
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,103,630 Number of Sequences: 369166 Number of extensions: 1723469 Number of successful extensions: 4556 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4556 length of database: 68,354,980 effective HSP length: 108 effective length of database: 48,403,600 effective search space used: 7018522000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)