Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_021_L22 (681 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q15637|SF01_HUMAN Splicing factor 1 (Zinc finger protein... 123 4e-28 sp|Q64213|SF01_MOUSE Splicing factor 1 (Zinc finger protein... 123 4e-28 sp|O01367|HOW_DROME Held out wings protein (KH-domain prote... 36 0.082 sp|Q17339|GLD1_CAEEL Female germline-specific tumor suppres... 34 0.31 sp|O95201|ZN205_HUMAN Zinc finger protein 205 (Zinc finger ... 32 2.0 sp|P20527|YVAR_VACCC Hypothetical 8.5 kDa protein 32 2.0 sp|P04023|GAG_IPHA Retrovirus-related Gag polyprotein 32 2.0 sp|P46471|PRS7_MOUSE 26S protease regulatory subunit 7 (MSS... 31 3.4 sp|Q9SSB5|PRS7_ARATH 26S protease regulatory subunit 7 (26S... 31 3.4 sp|P07900|HS90A_HUMAN Heat shock protein HSP 90-alpha (HSP 86) 31 3.4
>sp|Q15637|SF01_HUMAN Splicing factor 1 (Zinc finger protein 162) (Transcription factor ZFM1) (Zinc finger gene in MEN1 locus) (Mammalian branch point binding protein mBBP) (BBP) Length = 639 Score = 123 bits (309), Expect = 4e-28 Identities = 65/127 (51%), Positives = 87/127 (68%), Gaps = 1/127 (0%) Frame = +1 Query: 61 EDEPLHAYITAPIRECVDKAIKRINEIIKEGVEVPENQNDLRKSQMKELALLNGTFREVD 240 EDEPLHA +TA E V KA+++I I+K+G+E PE+QNDLRK Q++ELA LNGT RE D Sbjct: 199 EDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDD 258 Query: 241 GINKLKAIAEAQT-IVTNTIICSLCGGVGHIPSDCKVKRPLNKIESCFSVEKTKMDSEYC 417 L+ ++T +TNT +C+ CGG GHI SDCK +RP + + +K +MD EY Sbjct: 259 N-RILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDPQS---AQDKARMDKEYL 314 Query: 418 ALMEELG 438 +LM ELG Sbjct: 315 SLMAELG 321
>sp|Q64213|SF01_MOUSE Splicing factor 1 (Zinc finger protein 162) (Transcription factor ZFM1) (mZFM) (Zinc finger gene in MEN1 locus) (Mammalian branch point binding protein mBBP) (BBP) (CW17) Length = 653 Score = 123 bits (309), Expect = 4e-28 Identities = 65/127 (51%), Positives = 87/127 (68%), Gaps = 1/127 (0%) Frame = +1 Query: 61 EDEPLHAYITAPIRECVDKAIKRINEIIKEGVEVPENQNDLRKSQMKELALLNGTFREVD 240 EDEPLHA +TA E V KA+++I I+K+G+E PE+QNDLRK Q++ELA LNGT RE D Sbjct: 199 EDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDD 258 Query: 241 GINKLKAIAEAQT-IVTNTIICSLCGGVGHIPSDCKVKRPLNKIESCFSVEKTKMDSEYC 417 L+ ++T +TNT +C+ CGG GHI SDCK +RP + + +K +MD EY Sbjct: 259 N-RILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDPQS---AQDKARMDKEYL 314 Query: 418 ALMEELG 438 +LM ELG Sbjct: 315 SLMAELG 321
>sp|O01367|HOW_DROME Held out wings protein (KH-domain protein KH93F) (Putative RNA-binding protein) (Muscle-specific protein) (Wings held out protein) (Struthio protein) (Quaking-related 93F) Length = 405 Score = 36.2 bits (82), Expect = 0.082 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = +1 Query: 67 EPLHAYITAPIRE--CVDKAIKRINEIIKEGVEVPENQNDLRKSQMKELALLNGTFRE 234 + LH IT E K + + E+ K V E +++L+K Q+ ELA++NGT+R+ Sbjct: 204 DDLHVLITVEDTENRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYRD 261
>sp|Q17339|GLD1_CAEEL Female germline-specific tumor suppressor gld-1 (Defective in germ line development protein 1) Length = 463 Score = 34.3 bits (77), Expect = 0.31 Identities = 13/45 (28%), Positives = 28/45 (62%) Frame = +1 Query: 130 INEIIKEGVEVPENQNDLRKSQMKELALLNGTFREVDGINKLKAI 264 + ++ K + PE ++L++ Q+ ELA++NGT+R + N + + Sbjct: 295 LEQVKKLLIPAPEGTDELKRKQLMELAIINGTYRPMKSPNPARVM 339
>sp|O95201|ZN205_HUMAN Zinc finger protein 205 (Zinc finger protein 210) Length = 504 Score = 31.6 bits (70), Expect = 2.0 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 381 QRGENENGQRILRPDGRVGRRSERCAQ 461 ++G E+G+ L PD VGR+S RC Q Sbjct: 236 EKGAPESGEEGLAPDSEVGRKSYRCEQ 262
>sp|P20527|YVAR_VACCC Hypothetical 8.5 kDa protein Length = 66 Score = 31.6 bits (70), Expect = 2.0 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = -1 Query: 300 NYRIRNDRLRFCDCFQFIYSVDFSERSIQKSQFFHLTFSQ--IILIFRNFNTF 148 N+RI+ DR F CF++++ F + +FH++ + +++IF N +F Sbjct: 7 NFRIQYDRRSFFKCFRYVF---FEIIHFMREYWFHVSTKEGKLVIIFMNLYSF 56
>sp|P04023|GAG_IPHA Retrovirus-related Gag polyprotein Length = 572 Score = 31.6 bits (70), Expect = 2.0 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = +1 Query: 283 VTNTIICSLCGGVGHIPSDCKVKRPLNKIESCFSVEKTKMDSEYCALMEELGVDR 447 ++N C CG +GH+ DC+ + + C+ K + C +M+ G D+ Sbjct: 443 LSNRKACFNCGRMGHLKKDCQAPERTRESKLCYRCGKGYHRASECGIMDS-GADK 496
>sp|P46471|PRS7_MOUSE 26S protease regulatory subunit 7 (MSS1 protein) Length = 433 Score = 30.8 bits (68), Expect = 3.4 Identities = 10/24 (41%), Positives = 19/24 (79%) Frame = -3 Query: 628 DSCFVRSVANKSGERYAGQGARMM 557 D+CF+R + ++ ++Y G+GARM+ Sbjct: 234 DACFIRVIGSELVQKYVGEGARMV 257
>sp|Q9SSB5|PRS7_ARATH 26S protease regulatory subunit 7 (26S proteasome subunit 7) (26S proteasome AAA-ATPase subunit RPT1a) (Regulatory particle triple-A ATPase subunit 1a) Length = 426 Score = 30.8 bits (68), Expect = 3.4 Identities = 10/24 (41%), Positives = 19/24 (79%) Frame = -3 Query: 628 DSCFVRSVANKSGERYAGQGARMM 557 D+CF+R + ++ ++Y G+GARM+ Sbjct: 227 DACFIRVIGSELVQKYVGEGARMV 250
>sp|P07900|HS90A_HUMAN Heat shock protein HSP 90-alpha (HSP 86) Length = 732 Score = 30.8 bits (68), Expect = 3.4 Identities = 20/82 (24%), Positives = 39/82 (47%) Frame = +1 Query: 67 EPLHAYITAPIRECVDKAIKRINEIIKEGVEVPENQNDLRKSQMKELALLNGTFREVDGI 246 EP+ Y ++E K + + KEG+E+PE++ + +K + K+ N D + Sbjct: 523 EPIDEYCVQQLKEFEGKTLVSVT---KEGLELPEDEEEKKKQEEKKTKFENLCKIMKDIL 579 Query: 247 NKLKAIAEAQTIVTNTIICSLC 312 K + +V+N ++ S C Sbjct: 580 EK----KVEKVVVSNRLVTSPC 597
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,254,437 Number of Sequences: 369166 Number of extensions: 1807099 Number of successful extensions: 5583 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 5292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5555 length of database: 68,354,980 effective HSP length: 107 effective length of database: 48,588,335 effective search space used: 5782011865 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)