Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_021_L19 (105 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q90835|EF1A_CHICK Elongation factor 1-alpha 1 (EF-1-alph... 68 7e-12 sp|P10126|EF1A1_MOUSE Elongation factor 1-alpha 1 (EF-1-alp... 67 1e-11 sp|P68105|EF1A1_RABIT Elongation factor 1-alpha 1 (EF-1-alp... 67 1e-11 sp|Q5R4R8|EF1A1_PONPY Elongation factor 1-alpha 1 (EF-1-alp... 67 1e-11 sp|P13549|EF1A0_XENLA Elongation factor 1-alpha, somatic fo... 67 1e-11 sp|P08736|EF11_DROME Elongation factor 1-alpha (EF-1-alpha)... 66 2e-11 sp|P29520|EF1A_BOMMO Elongation factor 1-alpha (EF-1-alpha) 64 8e-11 sp|Q26487|EF1A_SPOFR Elongation factor 1-alpha (EF-1-alpha) 64 1e-10 sp|P84316|EF1A_HELZE Elongation factor 1-alpha (EF-1-alpha)... 64 1e-10 sp|O42820|EF1A_SCHCO Elongation factor 1-alpha (EF-1-alpha) 64 1e-10
>sp|Q90835|EF1A_CHICK Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor Tu) (EF-Tu) Length = 462 Score = 67.8 bits (164), Expect = 7e-12 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +2 Query: 5 VAFVPISGWNGDNMIEESTNMPWYKGWEITRKN 103 VAFVPISGWNGDNM+E S+NMPW+KGW++TRK+ Sbjct: 188 VAFVPISGWNGDNMLEPSSNMPWFKGWKVTRKD 220
>sp|P10126|EF1A1_MOUSE Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) sp|P62630|EF1A1_RAT Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) sp|P62629|EF1A1_CRIGR Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) Length = 462 Score = 67.4 bits (163), Expect = 1e-11 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 5 VAFVPISGWNGDNMIEESTNMPWYKGWEITRKN 103 VAFVPISGWNGDNM+E S NMPW+KGW++TRK+ Sbjct: 188 VAFVPISGWNGDNMLEPSANMPWFKGWKVTRKD 220
>sp|P68105|EF1A1_RABIT Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) sp|Q5R1X2|EF1A1_PANTR Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) sp|P68103|EF1A1_BOVIN Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) sp|P68104|EF1A1_HUMAN Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) sp|Q66RN5|EF1A1_FELCA Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) Length = 462 Score = 67.4 bits (163), Expect = 1e-11 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 5 VAFVPISGWNGDNMIEESTNMPWYKGWEITRKN 103 VAFVPISGWNGDNM+E S NMPW+KGW++TRK+ Sbjct: 188 VAFVPISGWNGDNMLEPSANMPWFKGWKVTRKD 220
>sp|Q5R4R8|EF1A1_PONPY Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) Length = 462 Score = 67.4 bits (163), Expect = 1e-11 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 5 VAFVPISGWNGDNMIEESTNMPWYKGWEITRKN 103 VAFVPISGWNGDNM+E S NMPW+KGW++TRK+ Sbjct: 188 VAFVPISGWNGDNMLEPSANMPWFKGWKVTRKD 220
>sp|P13549|EF1A0_XENLA Elongation factor 1-alpha, somatic form (EF-1-alpha-S) Length = 462 Score = 67.0 bits (162), Expect = 1e-11 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 5 VAFVPISGWNGDNMIEESTNMPWYKGWEITRK 100 VAFVPISGWNGDNM+E S NMPW+KGW+ITRK Sbjct: 188 VAFVPISGWNGDNMLEPSPNMPWFKGWKITRK 219
>sp|P08736|EF11_DROME Elongation factor 1-alpha (EF-1-alpha) (50 kDa female-specific protein) Length = 463 Score = 66.2 bits (160), Expect = 2e-11 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 2 AVAFVPISGWNGDNMIEESTNMPWYKGWEITRK 100 AVAFVPISGW+GDNM+E STNMPW+KGW++ RK Sbjct: 187 AVAFVPISGWHGDNMLEPSTNMPWFKGWKVERK 219
>sp|P29520|EF1A_BOMMO Elongation factor 1-alpha (EF-1-alpha) Length = 463 Score = 64.3 bits (155), Expect = 8e-11 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 2 AVAFVPISGWNGDNMIEESTNMPWYKGWEITRK 100 AVAFVPISGW+GDNM+E ST MPW+KGW++ RK Sbjct: 187 AVAFVPISGWHGDNMLEPSTKMPWFKGWQVERK 219
>sp|Q26487|EF1A_SPOFR Elongation factor 1-alpha (EF-1-alpha) Length = 413 Score = 63.5 bits (153), Expect = 1e-10 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 2 AVAFVPISGWNGDNMIEESTNMPWYKGWEITRK 100 AVAFVPISGW+GDNM+E ST MPW+KGW + RK Sbjct: 173 AVAFVPISGWHGDNMLEASTKMPWFKGWNVERK 205
>sp|P84316|EF1A_HELZE Elongation factor 1-alpha (EF-1-alpha) sp|P84315|EF1A_HELVI Elongation factor 1-alpha (EF-1-alpha) sp|P84318|EF1A_HELGL Elongation factor 1-alpha (EF-1-alpha) sp|P84320|EF1A_HELDI Elongation factor 1-alpha (EF-1-alpha) sp|P84317|EF1A_HELAM Elongation factor 1-alpha (EF-1-alpha) sp|P84319|EF1A_HELAL Elongation factor 1-alpha (EF-1-alpha) sp|P84322|EF1A_ANIIF Elongation factor 1-alpha (EF-1-alpha) sp|P84321|EF1A_ADIBE Elongation factor 1-alpha (EF-1-alpha) Length = 413 Score = 63.5 bits (153), Expect = 1e-10 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 2 AVAFVPISGWNGDNMIEESTNMPWYKGWEITRK 100 AVAFVPISGW+GDNM+E ST MPW+KGW + RK Sbjct: 173 AVAFVPISGWHGDNMLEASTKMPWFKGWNVERK 205
>sp|O42820|EF1A_SCHCO Elongation factor 1-alpha (EF-1-alpha) Length = 460 Score = 63.5 bits (153), Expect = 1e-10 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +2 Query: 5 VAFVPISGWNGDNMIEESTNMPWYKGW 85 VAFVPISGW+GDNM+EESTNMPWYKGW Sbjct: 186 VAFVPISGWHGDNMLEESTNMPWYKGW 212
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,696,126 Number of Sequences: 369166 Number of extensions: 140383 Number of successful extensions: 558 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 558 length of database: 68,354,980 effective HSP length: 9 effective length of database: 66,692,365 effective search space used: 1667309125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)