Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_021_F09 (382 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q58295|DPOL_METJA DNA polymerase [Contains: Mja pol-1 in... 34 0.12 sp|Q8N3Y1|FBXW8_HUMAN F-box/WD-repeat protein 8 (F-box and ... 32 0.59 sp|Q9P567|SUCB_NEUCR Probable succinyl-CoA ligase [GDP-form... 31 0.77 sp|Q08204|SMC5_YEAST Structural maintenance of chromosome 5 29 2.9 sp|P54197|CHI2_COCIM Endochitinase 2 precursor 29 2.9 sp|P21249|ANT1_ONCVO Major antigen (Myosin-like antigen) 29 2.9 sp|Q15814|TBCC_HUMAN Tubulin-specific chaperone C (Tubulin-... 29 3.8 sp|Q09800|YAA7_SCHPO Hypothetical protein C22G7.07c in chro... 29 3.8 sp|Q5HEQ1|RECX_STAAC Regulatory protein recX >gi|27805680|s... 29 3.8 sp|P66003|RECX_STAAN Regulatory protein recX >gi|54041803|s... 29 3.8
>sp|Q58295|DPOL_METJA DNA polymerase [Contains: Mja pol-1 intein; Mja pol-2 intein] Length = 1634 Score = 33.9 bits (76), Expect = 0.12 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +1 Query: 145 EILDLVKDLLRLESDPAKLQRISKLLNDLNRKGYSFEKLRKK 270 +I + + DL+R D K IS++L N K +SF+K+ KK Sbjct: 902 KIGEYIDDLMRKHKDKIKFSGISEILETKNLKTFSFDKITKK 943
>sp|Q8N3Y1|FBXW8_HUMAN F-box/WD-repeat protein 8 (F-box and WD-40 domain protein 8) (F-box only protein 29) Length = 598 Score = 31.6 bits (70), Expect = 0.59 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 137 RLFTVENILSGIVCSSVSKRPPTIFVSGNPDSNL 36 RL + N+L C ++S PP + VSGN D + Sbjct: 424 RLLKLGNVLRDFTCVNLSDSPPNLMVSGNMDGRV 457
>sp|Q9P567|SUCB_NEUCR Probable succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursor (Succinyl-CoA synthetase, beta chain) (SCS-beta) Length = 447 Score = 31.2 bits (69), Expect = 0.77 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 1/88 (1%) Frame = +1 Query: 64 NIVGGLLDTLEQTIPLNIFSTVKSLLNEILDL-VKDLLRLESDPAKLQRISKLLNDLNRK 240 NI GG++ I + +TVKSL DL + + RL+ ++ +L+ND K Sbjct: 360 NIFGGIVRC--DAIAHGLINTVKSL-----DLKIPIIARLQG--TNMEAARQLINDSGMK 410 Query: 241 GYSFEKLRKKYFRDVDLSAVVKAKVDVN 324 +S + L+ + V LS VVK D++ Sbjct: 411 IFSIDDLQSAAEKSVQLSKVVKMARDID 438
>sp|Q08204|SMC5_YEAST Structural maintenance of chromosome 5 Length = 1093 Score = 29.3 bits (64), Expect = 2.9 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 4/90 (4%) Frame = +1 Query: 61 TNIVGGLLDTLEQTIPLNIFSTVKSLLNEILDLVKDLLRLESDPA----KLQRISKLLND 228 TN G + + EQ I I + + +L NE D L L + + +L ++ +D Sbjct: 643 TNFYQGSIMSNEQKI--RIENEIINLKNEYNDRKSTLDALSNQKSGYRHELSELASKNDD 700 Query: 229 LNRKGYSFEKLRKKYFRDVDLSAVVKAKVD 318 +NR+ + ++RKKY ++ K+D Sbjct: 701 INREAHQLNEIRKKYTMRKSTIETLREKLD 730
>sp|P54197|CHI2_COCIM Endochitinase 2 precursor Length = 860 Score = 29.3 bits (64), Expect = 2.9 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = -3 Query: 161 TKSRISFNRLFTVENILSGIVCSSVSKRPPTIFVSGNPDSNLSKPST--PPFP 9 T+S+ S + F+ +++ + + + + PT ++G P +S P+T PP P Sbjct: 606 TRSQGSPSETFSTKSVPVDTISTELPSQTPTTIITGTPSDPVSAPTTTVPPNP 658
>sp|P21249|ANT1_ONCVO Major antigen (Myosin-like antigen) Length = 2022 Score = 29.3 bits (64), Expect = 2.9 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 2/79 (2%) Frame = +1 Query: 61 TNIVGGLLDTLEQ--TIPLNIFSTVKSLLNEILDLVKDLLRLESDPAKLQRISKLLNDLN 234 TN + L T+ Q TI I + LNE L DL L+ A+++ K++ND Sbjct: 1676 TNRLNSLEKTVSQQRTIETEIRQQLSLALNERNTLQNDLRDLQRRLARMETEKKIMND-- 1733 Query: 235 RKGYSFEKLRKKYFRDVDL 291 K EK+R + ++L Sbjct: 1734 -KYDELEKIRASLIKRIEL 1751
>sp|Q15814|TBCC_HUMAN Tubulin-specific chaperone C (Tubulin-folding cofactor C) (CFC) Length = 346 Score = 28.9 bits (63), Expect = 3.8 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +1 Query: 118 FSTVKSLLNEILDLVKDLLRLESDPAKLQRISKLLND 228 F+ ++ + E+L+ + + RLE ++LQ + KL+ND Sbjct: 64 FARERAAVEELLERAESVERLEEAASRLQGLQKLIND 100
>sp|Q09800|YAA7_SCHPO Hypothetical protein C22G7.07c in chromosome I Length = 413 Score = 28.9 bits (63), Expect = 3.8 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -3 Query: 122 ENILSGIVCSSVS----KRPPTIFVSGNPDSNLSKPSTPPF 12 E +L G+ S K PPT + G PD + KPS PF Sbjct: 326 EQLLIGVTSEYTSVYSDKIPPTFTIIGIPDYHSRKPSLKPF 366
>sp|Q5HEQ1|RECX_STAAC Regulatory protein recX sp|Q8NVU3|RECX_STAAW Regulatory protein recX sp|Q6G861|RECX_STAAS Regulatory protein recX Length = 272 Score = 28.9 bits (63), Expect = 3.8 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +1 Query: 82 LDTLEQTIPLNIFSTVKSLLNEIL--DLVKDLLRLESDPAKLQRISKLLNDLNRKGYSFE 255 ++T+ + F+ +++L+++L DL K + + + ISK + L RKGY ++ Sbjct: 194 METIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQKLISKTIEGLMRKGYKYD 253 Query: 256 KLRKK 270 K++ K Sbjct: 254 KIKAK 258
>sp|P66003|RECX_STAAN Regulatory protein recX sp|P66002|RECX_STAAM Regulatory protein recX sp|Q6GFI4|RECX_STAAR Regulatory protein recX Length = 272 Score = 28.9 bits (63), Expect = 3.8 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +1 Query: 82 LDTLEQTIPLNIFSTVKSLLNEIL--DLVKDLLRLESDPAKLQRISKLLNDLNRKGYSFE 255 ++T+ + F+ +++L+++L DL K + + + ISK + L RKGY ++ Sbjct: 194 METIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQKLISKTIEGLMRKGYKYD 253 Query: 256 KLRKK 270 K++ K Sbjct: 254 KIKAK 258
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,927,331 Number of Sequences: 369166 Number of extensions: 688779 Number of successful extensions: 2705 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2703 length of database: 68,354,980 effective HSP length: 93 effective length of database: 51,174,625 effective search space used: 1688762625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)