Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_020_K20 (496 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q12400|TRM10_YEAST tRNA (guanine-N(1)-)-methyltransferas... 55 7e-08 sp|Q75A17|TRM10_ASHGO tRNA (guanine-N(1)-)-methyltransferas... 44 3e-04 sp|Q09287|YQK3_CAEEL Hypothetical protein C56G2.3 in chromo... 43 5e-04 sp|P46186|RSEB_ECOLI Sigma-E factor regulatory protein rseB... 30 2.4 sp|O70435|PSA3_MOUSE Proteasome subunit alpha type 3 (Prote... 30 4.1 sp|P25788|PSA3_HUMAN Proteasome subunit alpha type 3 (Prote... 30 4.1 sp|P18422|PSA3_RAT Proteasome subunit alpha type 3 (Proteas... 30 4.1 sp|Q7T3T8|ZAR1_BRARE Zygote arrest 1 (Oocyte-specific mater... 30 4.1 sp|P40856|SA185_YEAST SIT4-associating protein SAP185 29 5.3 sp|Q58817|RFCS_METJA Replication factor C small subunit (RF... 29 5.3
>sp|Q12400|TRM10_YEAST tRNA (guanine-N(1)-)-methyltransferase TRM10 (tRNA methyltransferase 10) Length = 293 Score = 55.5 bits (132), Expect = 7e-08 Identities = 36/127 (28%), Positives = 68/127 (53%), Gaps = 2/127 (1%) Frame = +2 Query: 56 KSNRFEILENTSFRIDQRPL--TEVYSRKELIYLSPNSSNIFEEGEYDHDATFVIGGLVD 229 K+ +E + F D + + E S+ +++YL+ ++ E+ E +++GG+VD Sbjct: 153 KNTNYENWNHFKFLPDDKIMFGDEHISKDKIVYLTADTEEKLEKLE--PGMRYIVGGIVD 210 Query: 230 LSEQLPLTLAKARKEGLKHRSLPLDRHINWVKGNKSLPLRQVFEILSIARETNGNWRSAL 409 + L L KA+K G+ R LP+D +IN ++G + L V +++ + + NW++A Sbjct: 211 KNRYKELCLKKAQKMGIPTRRLPIDEYIN-LEGRRVLTTTHVVQLM-LKYFDDHNWKNAF 268 Query: 410 RHSLPPR 430 LPPR Sbjct: 269 ESVLPPR 275
>sp|Q75A17|TRM10_ASHGO tRNA (guanine-N(1)-)-methyltransferase (tRNA methyltransferase 10) Length = 296 Score = 43.5 bits (101), Expect = 3e-04 Identities = 29/105 (27%), Positives = 51/105 (48%) Frame = +2 Query: 143 IYLSPNSSNIFEEGEYDHDATFVIGGLVDLSEQLPLTLAKARKEGLKHRSLPLDRHINWV 322 +YL+ ++ E E T+++GG+VD + L KA++ G+ R LP+ +I + Sbjct: 179 VYLTADTDETLETLE--PGTTYIVGGIVDKNRHKALCYNKAKELGIPTRRLPIGEYIK-L 235 Query: 323 KGNKSLPLRQVFEILSIARETNGNWRSALRHSLPPRIVTPIGHRA 457 G K L V +I+ + N +W+ A LP R + + A Sbjct: 236 CGRKVLTTTHVIQIM-LRYFDNHDWKEAFESVLPARKLAELADHA 279
>sp|Q09287|YQK3_CAEEL Hypothetical protein C56G2.3 in chromosome III Length = 318 Score = 42.7 bits (99), Expect = 5e-04 Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 1/107 (0%) Frame = +2 Query: 113 LTEVYSRK-ELIYLSPNSSNIFEEGEYDHDATFVIGGLVDLSEQLPLTLAKARKEGLKHR 289 + E Y + IY+S N+ ++ + G D VIG V + + L+ AR+ ++ Sbjct: 179 IKEFYGKSANTIYISSNARDVLD-GPLTAD---VIGICVTMGRKRE-ALSAARRANIRAY 233 Query: 290 SLPLDRHINWVKGNKSLPLRQVFEILSIARETNGNWRSALRHSLPPR 430 LP+ R++ W G + LP + +L G+W AL +++ R Sbjct: 234 RLPIHRYVKWKSGPQYLPFPNIMNVLREVYMNGGDWSRALHNNISKR 280
>sp|P46186|RSEB_ECOLI Sigma-E factor regulatory protein rseB precursor Length = 318 Score = 30.4 bits (67), Expect = 2.4 Identities = 32/178 (17%), Positives = 70/178 (39%), Gaps = 40/178 (22%) Frame = +2 Query: 44 FLSHKSNRFEILENTSFRIDQRPLTEVYS----RKELI-------YLSPNSSNIFEEGEY 190 F+S E L R+D RPL ++ R+E++ Y P G+Y Sbjct: 47 FISINKQGVESLRYRHARLDNRPLAQLLQMDGPRREVVQRGNEISYFEPGLEPFTLNGDY 106 Query: 191 DHDAT----------------FVIGGLVDLSEQLPLTLAKARKEGLKHRSLPLDRHINWV 322 D+ F+ G ++++L + ++G ++ +I W+ Sbjct: 107 IVDSLPSLIYTDFKRLSPYYDFISVGRTRIADRLCEVIRVVARDGTRYS------YIVWM 160 Query: 323 KGNKSLPLR-----------QVFEILS--IARETNGNWRSALRHSLPPRIVTPIGHRA 457 LP+R + F +++ + ++ + + ++ + +LPP + P+G +A Sbjct: 161 DTESKLPMRVDLLDRDGETLEQFRVIAFNVNQDISSSMQTLAKANLPPLLSVPVGEKA 218
>sp|O70435|PSA3_MOUSE Proteasome subunit alpha type 3 (Proteasome component C8) (Macropain subunit C8) (Multicatalytic endopeptidase complex subunit C8) (Proteasome subunit K) Length = 255 Score = 29.6 bits (65), Expect = 4.1 Identities = 18/59 (30%), Positives = 27/59 (45%) Frame = +2 Query: 248 LTLAKARKEGLKHRSLPLDRHINWVKGNKSLPLRQVFEILSIARETNGNWRSALRHSLP 424 L L+K +EG R +DRH+ L + IARE N+RS +++P Sbjct: 53 LVLSKLYEEGSNKRLFNVDRHVGMAVAGL---LADARSLADIAREEASNFRSNFGYNIP 108
>sp|P25788|PSA3_HUMAN Proteasome subunit alpha type 3 (Proteasome component C8) (Macropain subunit C8) (Multicatalytic endopeptidase complex subunit C8) Length = 255 Score = 29.6 bits (65), Expect = 4.1 Identities = 18/59 (30%), Positives = 27/59 (45%) Frame = +2 Query: 248 LTLAKARKEGLKHRSLPLDRHINWVKGNKSLPLRQVFEILSIARETNGNWRSALRHSLP 424 L L+K +EG R +DRH+ L + IARE N+RS +++P Sbjct: 53 LVLSKLYEEGSNKRLFNVDRHVGMAVAGL---LADARSLADIAREEASNFRSNFGYNIP 108
>sp|P18422|PSA3_RAT Proteasome subunit alpha type 3 (Proteasome component C8) (Macropain subunit C8) (Multicatalytic endopeptidase complex subunit C8) (Proteasome subunit K) Length = 255 Score = 29.6 bits (65), Expect = 4.1 Identities = 18/59 (30%), Positives = 27/59 (45%) Frame = +2 Query: 248 LTLAKARKEGLKHRSLPLDRHINWVKGNKSLPLRQVFEILSIARETNGNWRSALRHSLP 424 L L+K +EG R +DRH+ L + IARE N+RS +++P Sbjct: 53 LVLSKLYEEGSNKRLFNVDRHVGMAVAGL---LADARSLADIAREEASNFRSNFGYNIP 108
>sp|Q7T3T8|ZAR1_BRARE Zygote arrest 1 (Oocyte-specific maternal effect factor) Length = 329 Score = 29.6 bits (65), Expect = 4.1 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 6/70 (8%) Frame = +2 Query: 125 YSRKELIYLSPNSSNIF----EEGEYDHDATFVIGGLVDLSEQLPLTLAKARKEGLKHRS 292 + R + +Y S + EEGE + D + VD +E+L RK+G K Sbjct: 127 FPRTQAVYSPVESRRLVSLFREEGEEEEDTDLEVTETVDSAEKLESAEKNVRKQGKKSAK 186 Query: 293 LPL--DRHIN 316 PL +++IN Sbjct: 187 QPLSPEKNIN 196
>sp|P40856|SA185_YEAST SIT4-associating protein SAP185 Length = 1058 Score = 29.3 bits (64), Expect = 5.3 Identities = 18/80 (22%), Positives = 37/80 (46%) Frame = +2 Query: 191 DHDATFVIGGLVDLSEQLPLTLAKARKEGLKHRSLPLDRHINWVKGNKSLPLRQVFEILS 370 D DAT + G V+ ++PL L ++ + K ++P N ++ ++ + Sbjct: 882 DSDATEQVPGEVNRDHKIPLKLKRSFTDACKSETIP----------NNTVNAKEE-SVFQ 930 Query: 371 IARETNGNWRSALRHSLPPR 430 + E + W S+ +S+P R Sbjct: 931 FSNELSDGWESSPSNSIPKR 950
>sp|Q58817|RFCS_METJA Replication factor C small subunit (RFC small subunit) (Clamp loader small subunit) [Contains: Mja RFC-1 intein; Mja RFC-2 intein; Mja RFC-3 intein] Length = 1847 Score = 29.3 bits (64), Expect = 5.3 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 311 INWVKGNKSLPLRQVFEILS-IARETNGNWRSALRHSL 421 + W K N LP + +++ + + NGNWR LRH L Sbjct: 944 MKWKKSNL-LPAEPIIKMIKKLENKINGNWRYILRHQL 980
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,295,642 Number of Sequences: 369166 Number of extensions: 1156921 Number of successful extensions: 3538 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3537 length of database: 68,354,980 effective HSP length: 102 effective length of database: 49,512,010 effective search space used: 3069744620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)