Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_020_F07 (423 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P17934|PA24_BUNMU Phospholipase A2, beta bungarotoxin A4... 30 2.7 sp|Q12986|NFX1_HUMAN Transcriptional repressor NF-X1 (Nucle... 29 3.5 sp|P16869|FHUE_ECOLI FhuE receptor precursor (Outer-membran... 29 4.6 sp|Q9XTB2|GPA13_CAEEL Guanine nucleotide-binding protein al... 28 6.0 sp|P40969|CBF3B_YEAST Centromere DNA-binding protein comple... 28 7.9
>sp|P17934|PA24_BUNMU Phospholipase A2, beta bungarotoxin A4 chain precursor (Phosphatidylcholine 2-acylhydrolase) Length = 147 Score = 29.6 bits (65), Expect = 2.7 Identities = 16/57 (28%), Positives = 27/57 (47%) Frame = +1 Query: 205 PPRNLDLFHFQNLLQKPEPCSVCFGTMSDTYIKMAGRDCMSCGRTIMDKECSSFINC 375 PP++LDL+ F+ +++ PC +G +D Y G +D+ C NC Sbjct: 23 PPQHLDLYQFKEMIRYTIPCEKTWGEYAD-YGCYCGAGGSGTPIDALDRCCYVHDNC 78
>sp|Q12986|NFX1_HUMAN Transcriptional repressor NF-X1 (Nuclear transcription factor, X box-binding, 1) Length = 1104 Score = 29.3 bits (64), Expect = 3.5 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Frame = +1 Query: 220 DLFHFQNLLQKPEPCSVCFGTMSDTYIKMAGRDCMSCGRTI---MDKECSSFINC 375 D H NLL P PC C M+ T R + CG+ + C + +NC Sbjct: 436 DCPHSCNLLCHPGPCPPCPAFMTKTCECGRTRHTVRCGQAVSVHCSNPCENILNC 490
>sp|P16869|FHUE_ECOLI FhuE receptor precursor (Outer-membrane receptor for Fe(III)-coprogen, Fe(III)-ferrioxamine B and Fe(III)-rhodotrulic acid) Length = 729 Score = 28.9 bits (63), Expect = 4.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 76 SNSYDRLRASKPMTTYADSAVNALMM 153 SNSYDR R++ P Y D +N + M Sbjct: 287 SNSYDRARSTAPDWAYNDKEINKVFM 312
>sp|Q9XTB2|GPA13_CAEEL Guanine nucleotide-binding protein alpha-13 subunit Length = 348 Score = 28.5 bits (62), Expect = 6.0 Identities = 17/62 (27%), Positives = 27/62 (43%) Frame = +1 Query: 43 EAVDSCHFCPDSNSYDRLRASKPMTTYADSAVNALMMPYNAPLMQNVLNYRALNPPRNLD 222 E +D+ FC + YD++ + +T D A+N L P Y LN +D Sbjct: 217 EGIDAIFFCIAISEYDQVMSEDMVTNRLDDALNLLQSISEDPAFATTPIYLFLN---EID 273 Query: 223 LF 228 +F Sbjct: 274 VF 275
>sp|P40969|CBF3B_YEAST Centromere DNA-binding protein complex CBF3 subunit B (Centromere protein 3) Length = 608 Score = 28.1 bits (61), Expect = 7.9 Identities = 15/60 (25%), Positives = 29/60 (48%) Frame = +1 Query: 154 PYNAPLMQNVLNYRALNPPRNLDLFHFQNLLQKPEPCSVCFGTMSDTYIKMAGRDCMSCG 333 PY+ PL+ N L + ++ +N + F+ LL S+ T+ + ++ G D + G Sbjct: 246 PYDEPLLANSLLTQCIHTFKNFHVDDFRPLLNDDPVESIAKVTLGRIFYRLCGCDYLQSG 305
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,750,496 Number of Sequences: 369166 Number of extensions: 915483 Number of successful extensions: 2256 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2256 length of database: 68,354,980 effective HSP length: 99 effective length of database: 50,066,215 effective search space used: 2052714815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)