Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_020_E21 (750 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P27571|XIST_MOUSE X inactive-specific transcript protein 31 4.1 sp|Q9TX43|CAR4_DICDI Cyclic AMP receptor 4 (cAMP receptor 4) 30 5.3 sp|P04540|NU5M_TRYBB NADH-ubiquinone oxidoreductase chain 5... 30 5.3
>sp|P27571|XIST_MOUSE X inactive-specific transcript protein Length = 298 Score = 30.8 bits (68), Expect = 4.1 Identities = 26/89 (29%), Positives = 44/89 (49%), Gaps = 1/89 (1%) Frame = +2 Query: 191 PILLCNLSI*T*HCCLISCFIYL*CYCFLINAVNICIPVR*LIFPIIISRNRL*-MC*VA 367 P++LC+ S+ C IS F L L++ VN C+ FP + L V+ Sbjct: 177 PLVLCSSSL----CQSISVFFLL-----LLSLVNSCLH----FFPAFLGPLSLFSFVFVS 223 Query: 368 LCFYCIFSIYLKYVSLLLP*CAVLCRYVI 454 LC++ ++ Y+S++L C LC Y++ Sbjct: 224 LCYW-----WISYLSIILLLCVCLCFYLL 247
>sp|Q9TX43|CAR4_DICDI Cyclic AMP receptor 4 (cAMP receptor 4) Length = 443 Score = 30.4 bits (67), Expect = 5.3 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -3 Query: 385 NTIETQRNSTHL*TISRNNNWENQLSNRNADIYSIDEK 272 N+ E + S L TI NNN+ N +N N + I+EK Sbjct: 396 NSFEITQPSNDLNTIENNNNYNNNNNNNNNNSLVIEEK 433
>sp|P04540|NU5M_TRYBB NADH-ubiquinone oxidoreductase chain 5 (NADH dehydrogenase subunit 5) Length = 590 Score = 30.4 bits (67), Expect = 5.3 Identities = 40/172 (23%), Positives = 71/172 (41%), Gaps = 23/172 (13%) Frame = +3 Query: 246 VLFIYSVIVFSSML*ISAFLLDN*FSQL--LFLEIVYRCVELRCV--------SIVFLVS 395 ++FI+ ++++ L + F + LFL Y C + C+ SI F++ Sbjct: 416 IIFIFFTMIYNYFLLFFLMFVFKCFCLVDCLFLLFDYECCLVYCLISLYMCILSIFFIID 475 Query: 396 I*NMYHCSSLNVLCCAVM*SH------LFVCHLLLVDYHP*Y*CCTLFRF----IYLCW- 542 ++ SS V + + +FV L+L Y C + F I L W Sbjct: 476 FVCIFVFSSYCVFWSFFLNFYNFFDIAIFVVFLILSVGFLYYGCLFFYFFNIDCIMLFWR 535 Query: 543 IYLLFLSMAAFMKRLSHHYC--YFIFTITIVLLPYWELLMYIRW**IYLFYF 692 I+ + + + FM +C YF+ I +LL W ++Y R+ Y +F Sbjct: 536 IFFVIIILVVFMI-----FCCWYFVCMIIFMLLFVWNFVIYFRYNLKYCLFF 582
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,011,158 Number of Sequences: 369166 Number of extensions: 1806047 Number of successful extensions: 3593 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3588 length of database: 68,354,980 effective HSP length: 108 effective length of database: 48,403,600 effective search space used: 6824907600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)