Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_020_B13 (742 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P93318|M660_ARATH Hypothetical mitochondrial protein AtM... 30 8.8 sp|Q56989|HMUR_YERPE Hemin receptor precursor 30 8.8
>sp|P93318|M660_ARATH Hypothetical mitochondrial protein AtMg00660 (ORF149) Length = 149 Score = 29.6 bits (65), Expect = 8.8 Identities = 17/51 (33%), Positives = 21/51 (41%) Frame = -3 Query: 527 AAWGKHKDIRCNIPNNTRWDRMNTAPRTGTRSCNIQNREGTPHCHKDPRLP 375 A W K K +RC+ P + PR R RE +PH D R P Sbjct: 23 ALWSKGKRVRCHTP------CLPKVPRGRARRSGATTREQSPHRQGDRRRP 67
>sp|Q56989|HMUR_YERPE Hemin receptor precursor Length = 676 Score = 29.6 bits (65), Expect = 8.8 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +3 Query: 351 RIRSTRIKWQPGVLMAVGCTLPVLNITA--TSTRTGGRIHTIPTRII 485 R S R +W + +A+ CTLP+ A T+T+T + H+ T ++ Sbjct: 3 RSTSDRFRWS-SLSLAIACTLPLATQAADTTTTQTSSKKHSTDTMVV 48
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,317,448 Number of Sequences: 369166 Number of extensions: 1112094 Number of successful extensions: 2333 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2328 length of database: 68,354,980 effective HSP length: 108 effective length of database: 48,403,600 effective search space used: 6679696800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)