Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_019_K04 (896 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q08810|IF2C_GALSU Translation initiation factor IF-2, ch... 35 0.28 sp|P47695|FTSH_MYCGE Cell division protein ftsH homolog 32 3.1 sp|O43312|MTSS1_HUMAN Metastasis suppressor protein 1 (Miss... 31 5.4 sp|Q02100|SKO1_YEAST CRE-binding bZIP protein SKO1 31 5.4 sp|Q8R1S4|MTSS1_MOUSE Metastasis suppressor protein 1 (Miss... 31 5.4 sp|Q9HFR4|ATG2_PICPA Autophagy-related protein 2 (Glucose-i... 31 5.4 sp|P47490|Y248_MYCGE Hypothetical protein MG248 30 7.0 sp|Q9CPB4|MRAW_PASMU S-adenosyl-methyltransferase mraW 30 7.0 sp|P59809|OXAA_CHLCV Inner membrane protein oxaA 30 9.1
>sp|Q08810|IF2C_GALSU Translation initiation factor IF-2, chloroplast Length = 259 Score = 35.0 bits (79), Expect = 0.28 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 5/73 (6%) Frame = +1 Query: 217 TNLLNCNSNMSSINTFNSTISPKEI-----NSNSKPHDFYLNHSSPLGYSAQANVNHVKS 381 ++LL N N + N NS + K I N N+K + F LN + Y++ N+N Sbjct: 29 SDLLKANKNNKTKNKKNSNFNFKSIEKNRLNYNNKKNKFILNRKAY--YNSNENINCQSD 86 Query: 382 TIYLVPNMVVNPI 420 IY+ N+ VN + Sbjct: 87 IIYVEENITVNEL 99
>sp|P47695|FTSH_MYCGE Cell division protein ftsH homolog Length = 702 Score = 31.6 bits (70), Expect = 3.1 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 10/84 (11%) Frame = +1 Query: 226 LNCNSNMS---SINTFNSTISPKEINSNSKPHDFYLNHS-------SPLGYSAQANVNHV 375 LN SN + ++ F++ ++ K+IN ++ D L S SPL +A VN Sbjct: 59 LNGGSNSTLTAKVSGFSNELTFKQINGSTYVTDTILQVSITFDGLNSPLTVTAHKTVNSN 118 Query: 376 KSTIYLVPNMVVNPINGMYMTVNN 447 + I+ + N+ +N NG +TVN+ Sbjct: 119 GNVIFNIANLSINQSNGQ-ITVNS 141
>sp|O43312|MTSS1_HUMAN Metastasis suppressor protein 1 (Missing in metastasis protein) (Metastasis suppressor YGL-1) Length = 755 Score = 30.8 bits (68), Expect = 5.4 Identities = 23/81 (28%), Positives = 36/81 (44%) Frame = +1 Query: 139 SHQILI*KNQSINEYSYTNVMQHPPSTNLLNCNSNMSSINTFNSTISPKEINSNSKPHDF 318 S Q+++ S +SY PST + +S SS+N+ NS+ S + + P Sbjct: 240 SEQVILDLKGSDYSWSY-QTPPSSPSTTMSRKSSVCSSLNSVNSSDSRSSGSHSHSPSSH 298 Query: 319 YLNHSSPLGYSAQANVNHVKS 381 Y SS L A ++ V S Sbjct: 299 YRYRSSNLAQQAPVRLSSVSS 319
>sp|Q02100|SKO1_YEAST CRE-binding bZIP protein SKO1 Length = 647 Score = 30.8 bits (68), Expect = 5.4 Identities = 21/59 (35%), Positives = 32/59 (54%) Frame = +1 Query: 139 SHQILI*KNQSINEYSYTNVMQHPPSTNLLNCNSNMSSINTFNSTISPKEINSNSKPHD 315 S I++ K S+N S N+ + +TN + NS + IN+ S +P IN+NS HD Sbjct: 578 SRPIILDKKYSLN--SGANISKSNTTTNNVG-NSAQNIINSCYSVTNPLVINANSDTHD 633
>sp|Q8R1S4|MTSS1_MOUSE Metastasis suppressor protein 1 (Missing in metastasis protein) Length = 759 Score = 30.8 bits (68), Expect = 5.4 Identities = 23/81 (28%), Positives = 36/81 (44%) Frame = +1 Query: 139 SHQILI*KNQSINEYSYTNVMQHPPSTNLLNCNSNMSSINTFNSTISPKEINSNSKPHDF 318 S Q+++ S +SY PST + +S SS+N+ NS+ S + + P Sbjct: 244 SEQVILDLKGSDYSWSY-QTPPSSPSTTMSRKSSVCSSLNSVNSSDSRSSGSHSHSPSSH 302 Query: 319 YLNHSSPLGYSAQANVNHVKS 381 Y SS L A ++ V S Sbjct: 303 YRYRSSNLAQQAPVRLSSVSS 323
>sp|Q9HFR4|ATG2_PICPA Autophagy-related protein 2 (Glucose-induced selective autophagy protein 11) (Pexophagy zeocin-resistant mutant protein 7) Length = 1862 Score = 30.8 bits (68), Expect = 5.4 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 9/79 (11%) Frame = +1 Query: 541 VYYDESLQVDDINNKNHIENRIRQSYNQNRHF---QRFKKNGQD---LPDDLAMKNDHF- 699 VY D SL++ D N+ E+ NR + + F++N +D L + L MK+DHF Sbjct: 1128 VYSDGSLEIID----NYYEHESVNQGLDNRTYGDLEVFEENSEDDISLENSLNMKHDHFY 1183 Query: 700 --SKQTNLKNLTSIPLNQN 750 S N +N +P N Sbjct: 1184 HTSFMDNTRNTEHVPFKLN 1202
>sp|P47490|Y248_MYCGE Hypothetical protein MG248 Length = 218 Score = 30.4 bits (67), Expect = 7.0 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = -2 Query: 829 FEIGCEEQQMVKKCIKENCKGFVLKSDFDSMEYLSNFSGWFVSKNDHF 686 ++IGC+ + IK N ++ SD LSN+ + + N HF Sbjct: 21 YDIGCDHSYLTSYLIKTNQNLTIVNSDISKNALLSNYQKFKNNNNIHF 68
>sp|Q9CPB4|MRAW_PASMU S-adenosyl-methyltransferase mraW Length = 321 Score = 30.4 bits (67), Expect = 7.0 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +1 Query: 628 RHFQRFKKNGQDLPDDLAMKNDHFSKQTNLKNLTSIPLNQNQISKQIP 771 +HF R + G+D+P L +++D + LK + + Q +Q P Sbjct: 261 KHFMRKQSKGEDIPKGLPLRDDQIQRTQTLKVIGKAIMPTEQEQQQNP 308
>sp|P59809|OXAA_CHLCV Inner membrane protein oxaA Length = 794 Score = 30.0 bits (66), Expect = 9.1 Identities = 17/78 (21%), Positives = 33/78 (42%) Frame = +1 Query: 160 KNQSINEYSYTNVMQHPPSTNLLNCNSNMSSINTFNSTISPKEINSNSKPHDFYLNHSSP 339 K ++ + Y N++ L N ++ ++TFNST+ E N S + L P Sbjct: 316 KKRTPSSYHALNIVS---GRELTNSVASGYRVSTFNSTMLELESNDGSIKKTYKLPQQQP 372 Query: 340 LGYSAQANVNHVKSTIYL 393 + + VN +++ Sbjct: 373 YAFEVEVGVNRASDDLWI 390
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,970,247 Number of Sequences: 369166 Number of extensions: 1910720 Number of successful extensions: 5134 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5107 length of database: 68,354,980 effective HSP length: 110 effective length of database: 48,034,130 effective search space used: 9030416440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)