Planarian EST Database

Dr_sW_019_J07

BLASTX 2.2.12 [Aug-07-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Dr_sW_019_J07
         (872 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q9P4Z1|TOM1_NEUCR  E3 ubiquitin protein ligase TOM1-like ...    30   8.8  

>sp|Q9P4Z1|TOM1_NEUCR E3 ubiquitin protein ligase TOM1-like protein
          Length = 4065

 Score = 30.0 bits (66), Expect = 8.8
 Identities = 17/68 (25%), Positives = 33/68 (48%)
 Frame = +3

Query: 93   KIYRVNKKACRCYASIRTRYKQTRCLIRPRNIIRRAAHVYHNGIYDSITTIFYRRHNCAC 272
            K+   + K      S+ ++Y+QTR    P  +  R  HV+H    DS  +++Y++ +   
Sbjct: 3679 KVLEFDNKRNYFNRSVHSKYQQTRHSFPPLQLQVRREHVFH----DSFRSLYYKKADELK 3734

Query: 273  LRRTSTRF 296
              + + RF
Sbjct: 3735 FGKLNIRF 3742

  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 47,311,630
Number of Sequences: 369166
Number of extensions: 687256
Number of successful extensions: 2339
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2309
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2337
length of database: 68,354,980
effective HSP length: 110
effective length of database: 48,034,130
effective search space used: 8646143400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)