Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_019_G07 (393 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8Y7F0|ENGC2_LISMO Probable GTPase engC 2 29 3.0 sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kina... 28 6.6 sp|P91766|ACH1_MANSE Acetylcholine receptor protein, alpha-... 28 6.6 sp|Q03428|NRKB_TRYBB Putative serine/threonine-protein kina... 28 6.6 sp|Q9P2G4|K1383_HUMAN Protein KIAA1383 28 8.6
>sp|Q8Y7F0|ENGC2_LISMO Probable GTPase engC 2 Length = 346 Score = 29.3 bits (64), Expect = 3.0 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +3 Query: 120 CILQDNSHTHKNNCLIRRYIKTSNITMEH 206 C D SHT + NC ++ ++ +TM+H Sbjct: 271 CRFHDCSHTQEPNCAVQAALEDGTLTMQH 299
>sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A Length = 431 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 105 LHLQLCILQDNSHTHKNNCLIRRYIKTSNITM 200 L LQLC+ D H+HK ++ R IK++N+ + Sbjct: 127 LFLQLCLALDYIHSHK---MLHRDIKSANVLL 155
>sp|P91766|ACH1_MANSE Acetylcholine receptor protein, alpha-like subunit precursor (MARA1) Length = 516 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -3 Query: 193 IFDVLIYRRIRQLFLWVWELSWRIHNCKWRPHEFG 89 + DV + +I LWV E SW + W P E+G Sbjct: 61 LIDVNLKNQIMTTNLWV-EQSWYDYKLSWEpreYG 94
>sp|Q03428|NRKB_TRYBB Putative serine/threonine-protein kinase B Length = 431 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 105 LHLQLCILQDNSHTHKNNCLIRRYIKTSNITM 200 L LQLC+ D H+HK ++ R IK++N+ + Sbjct: 127 LFLQLCLALDYIHSHK---MLHRDIKSANVLL 155
>sp|Q9P2G4|K1383_HUMAN Protein KIAA1383 Length = 905 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 182 DIKYNNGAPMPPYPVNLNQENPPP 253 D++ N P P Y NL QE PPP Sbjct: 293 DMETNIFCPPPLYYTNLTQEKPPP 316
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,864,696 Number of Sequences: 369166 Number of extensions: 639524 Number of successful extensions: 1503 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1500 length of database: 68,354,980 effective HSP length: 96 effective length of database: 50,620,420 effective search space used: 1721094280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)