Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_019_F09 (269 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P54190|TES26_TOXCA 26 kDa secreted antigen precursor (To... 40 0.001 sp|Q09662|YS51_CAEEL Hypothetical protein ZK673.1 in chromo... 38 0.008 sp|P24821|TENA_HUMAN Tenascin precursor (TN) (Hexabrachion)... 32 0.46 sp|Q19673|TYR3_CAEEL Putative tyrosinase-like protein tyr-3... 32 0.46 sp|Q6L8H4|KRA51_HUMAN Keratin-associated protein 5-1 (Kerat... 31 0.78 sp|P55115|NAS15_CAEEL Zinc metalloproteinase nas-15 precurs... 31 1.0 sp|P54108|CRIS3_HUMAN Cysteine-rich secretory protein 3 pre... 30 1.3 sp|P55952|MT_POTPO Metallothionein (MT) 30 1.3 sp|P17495|DISB_TRIGA Disintegrin trigramin-beta (Platelet a... 30 1.7 sp|P12940|IBB_HORVU Bowman-Birk type trypsin inhibitor 30 1.7
>sp|P54190|TES26_TOXCA 26 kDa secreted antigen precursor (Toxocara excretory-secretory antigen 26) (TES-26) Length = 262 Score = 40.4 bits (93), Expect = 0.001 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 7/90 (7%) Frame = +3 Query: 3 VAANCEIECVDREAYCAKPDINCLDGTTVE----KCPLACHLCGPCADSRSDCA---ELK 161 V++ +C+D + CA +C + +C C+ C C D ++CA L Sbjct: 15 VSSGVAQQCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCD-CRDEANNCAASINLC 73 Query: 162 KNITCKRIFRLFCRKTCGYCS*SNFVFDNI 251 +N T + + R C+KTCG C+ F+ I Sbjct: 74 QNPTFEPLVRDRCQKTCGLCAGCGFISSGI 103
>sp|Q09662|YS51_CAEEL Hypothetical protein ZK673.1 in chromosome II precursor Length = 154 Score = 37.7 bits (86), Expect = 0.008 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 14/57 (24%) Frame = +3 Query: 96 CPLACHLCG--------PCADSRSDCAELKKNITCKRIF------RLFCRKTCGYCS 224 CP C CG C DS ++CA +KN C F + +C KTC C+ Sbjct: 95 CPKTCGFCGGGSTAAPVQCVDSSTNCANWEKNGFCSSTFYDCANKKQYCAKTCKLCT 151
Score = 29.6 bits (65), Expect = 2.3 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 7/55 (12%) Frame = +3 Query: 78 GTTVEKCPLACH---LCGPCADS-RSDCAE---LKKNITCKRIFRLFCRKTCGYC 221 GTTV A CAD +DC + L N + + FC KTCG+C Sbjct: 48 GTTVSGATTAASGATTASTCADDPNTDCTQYTSLCSNAKYTPLLQQFCPKTCGFC 102
>sp|P24821|TENA_HUMAN Tenascin precursor (TN) (Hexabrachion) (Cytotactin) (Neuronectin) (GMEM) (JI) (Miotendinous antigen) (Glioma-associated-extracellular matrix antigen) (GP 150-225) (Tenascin-C) (TN-C) Length = 2201 Score = 32.0 bits (71), Expect = 0.46 Identities = 19/59 (32%), Positives = 24/59 (40%), Gaps = 5/59 (8%) Frame = +3 Query: 15 CEIECVDREAYCAKPDINCLDGTTVEKC-----PLACHLCGPCADSRSDCAELKKNITC 176 C +C DR C C +G T E C P ACH G C + + C E + C Sbjct: 315 CPNDCFDR-GRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQCVCDEGFAGLDC 372
Score = 28.9 bits (63), Expect = 3.9 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +3 Query: 18 EIECVDREAYCAKPDINCLDGTTVEKCPLACHLCGPCADSRSDC 149 E +CV E + ++C + ++CP CH G C D R +C Sbjct: 358 EGQCVCDEGFAG---LDCSE----KRCPADCHNRGRCVDGRCEC 394
Score = 28.1 bits (61), Expect = 6.6 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +3 Query: 24 ECVDREAYCAKPDINCLDGTTVEKCPLACHLCGPCADSRSDCAELKKNITC 176 +CV E + K +C + ++CP CH G C D + C E + C Sbjct: 546 QCVCHEGFMGK---DCKE----QRCPSDCHGQGRCVDGQCICHEGFTGLDC 589
>sp|Q19673|TYR3_CAEEL Putative tyrosinase-like protein tyr-3 precursor Length = 683 Score = 32.0 bits (71), Expect = 0.46 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 8/51 (15%) Frame = +3 Query: 93 KCPLACHLC------GPCADSRSDCAELKKNITC--KRIFRLFCRKTCGYC 221 +C ++C +C GPCAD DCA + C + CR++C C Sbjct: 607 QCKVSCGVCRPNYVYGPCADYHYDCAAWARRGECLKNKWMPENCRRSCNTC 657
>sp|Q6L8H4|KRA51_HUMAN Keratin-associated protein 5-1 (Keratin-associated protein 5.1) (Ultrahigh sulfur keratin-associated protein 5.1) Length = 278 Score = 31.2 bits (69), Expect = 0.78 Identities = 17/63 (26%), Positives = 22/63 (34%) Frame = +3 Query: 27 CVDREAYCAKPDINCLDGTTVEKCPLACHLCGPCADSRSDCAELKKNITCKRIFRLFCRK 206 C + C C G V C +C CG CA S+ C +C + C Sbjct: 190 CGGSKGGCGSGCGGCGSGCGVPVCCCSCSSCGSCAGSKGGCGSSCSQCSCCK--PCCCSS 247 Query: 207 TCG 215 CG Sbjct: 248 GCG 250
>sp|P55115|NAS15_CAEEL Zinc metalloproteinase nas-15 precursor (Nematode astacin 15) Length = 571 Score = 30.8 bits (68), Expect = 1.0 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 126 CADSRSDCAELKKNITCK---RIFRLFCRKTCGYC 221 C D R DC L CK + +C K+CG+C Sbjct: 437 CEDLRVDCLVLVSQRYCKISQNFMKSYCAKSCGFC 471
>sp|P54108|CRIS3_HUMAN Cysteine-rich secretory protein 3 precursor (CRISP-3) (SGP28 protein) Length = 245 Score = 30.4 bits (67), Expect = 1.3 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +3 Query: 33 DREAYCAKPDINCLDGTTVEKCPLACHLCGPCADSRSDCAELKKNITCK-RIFRLFCRKT 209 ++ A CA NC DG C D S+C LK +TCK ++ R C+ + Sbjct: 186 EQGAPCASCPDNCDDGLCTNGCKYE--------DLYSNCKSLKLTLTCKHQLVRDSCKAS 237 Query: 210 CGYCS 224 C CS Sbjct: 238 CN-CS 241
>sp|P55952|MT_POTPO Metallothionein (MT) Length = 58 Score = 30.4 bits (67), Expect = 1.3 Identities = 17/58 (29%), Positives = 21/58 (36%) Frame = +3 Query: 48 CAKPDINCLDGTTVEKCPLACHLCGPCADSRSDCAELKKNITCKRIFRLFCRKTCGYC 221 CA+ C +G C C PC S+C E K C + C K C C Sbjct: 5 CAEGTCECEEGKCKAGCKCTSCRCSPCEKCTSEC-ECKSKEECAK----NCTKPCSCC 57
>sp|P17495|DISB_TRIGA Disintegrin trigramin-beta (Platelet aggregation activation inhibitor) Length = 73 Score = 30.0 bits (66), Expect = 1.7 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = +3 Query: 36 REAYCAKPDINCLDGTTVEKCPLACHLCGPCADSRSDCAELKKNITCKR 182 ++ C P C D T + P A GPC D C+ +KK C+R Sbjct: 4 KDCDCGSPANPCCDAATCKLLPGAQCGEGPCCD---QCSFMKKGTICRR 49
>sp|P12940|IBB_HORVU Bowman-Birk type trypsin inhibitor Length = 124 Score = 30.0 bits (66), Expect = 1.7 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 4/48 (8%) Frame = +3 Query: 24 ECVDREAYCAK---PDINCLDGTTVEKCPLACHLCGPCAD-SRSDCAE 155 +C D EA C + P C+D V +CP C CGP D SR C + Sbjct: 8 KCCD-EAVCTRSIPPICTCMD--EVFECPKTCKSCGPMGDPSRRICQD 52
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,236,878 Number of Sequences: 369166 Number of extensions: 609638 Number of successful extensions: 2049 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2046 length of database: 68,354,980 effective HSP length: 59 effective length of database: 57,455,615 effective search space used: 1723668450 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)