Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_019_C01 (801 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P43212|PGLR2_CRYJA Polygalacturonase precursor (PG) (Pec... 32 2.6 sp|P35352|CAR3_DICDI Cyclic AMP receptor 3 (cAMP receptor 3) 31 4.5 sp|Q9NU19|TB22B_HUMAN TBC1 domain family member 22B 30 7.7 sp|Q95LL3|TB22B_MACFA TBC1 domain family member 22B 30 7.7 sp|P82144|PLIGA_AGKBL Phospholipase A2 inhibitor gamma subu... 30 7.7 sp|P51528|PA1_VESMC Phospholipase A1 (Allergen Ves m 1) (Ve... 30 7.7
>sp|P43212|PGLR2_CRYJA Polygalacturonase precursor (PG) (Pectinase) (Major pollen allergen Cry j 2) (Cry j II) Length = 514 Score = 31.6 bits (70), Expect = 2.6 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = -3 Query: 637 ISVRSLSGVLLICCNLT*HNSGLFSGNISINGCCSKCPSIRSRNSKSQKH 488 IS++ SG + C N + +G FSG++ I C + PS + + SKS KH Sbjct: 398 ISLKLTSGKIASCLND--NANGYFSGHV-IPACKNLSPSAKRKESKSHKH 444
>sp|P35352|CAR3_DICDI Cyclic AMP receptor 3 (cAMP receptor 3) Length = 490 Score = 30.8 bits (68), Expect = 4.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 773 HKNHNQRANSIHNRRDNTNNN 711 H NHN N+ HN +N NNN Sbjct: 324 HHNHNNNHNNNHNNHNNNNNN 344
>sp|Q9NU19|TB22B_HUMAN TBC1 domain family member 22B Length = 505 Score = 30.0 bits (66), Expect = 7.7 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 139 YYDSRNSENY*IGYRYNHLDLCRFN 213 YYDSRN E++ YR H+D+ R N Sbjct: 252 YYDSRNEEHHQDTYRQIHIDIPRTN 276
>sp|Q95LL3|TB22B_MACFA TBC1 domain family member 22B Length = 505 Score = 30.0 bits (66), Expect = 7.7 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 139 YYDSRNSENY*IGYRYNHLDLCRFN 213 YYDSRN E++ YR H+D+ R N Sbjct: 252 YYDSRNEEHHQDTYRQIHIDIPRTN 276
>sp|P82144|PLIGA_AGKBL Phospholipase A2 inhibitor gamma subunit A precursor (PLI-gamma A) (Phospholipase A2 inhibitor gamma 25 kDa subunit) Length = 200 Score = 30.0 bits (66), Expect = 7.7 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = -3 Query: 601 CCNLT*HNSGLFSGNISIN--GCCSKCPSIRSRNSKSQKHFHAINNSVQC 458 C N+ H + G+IS N GC S CP + NS +++ + + V+C Sbjct: 143 CINIVGHRHENYPGDISYNLKGCVSSCPLLSLSNSTHEENRNYL-EKVEC 191
>sp|P51528|PA1_VESMC Phospholipase A1 (Allergen Ves m 1) (Ves m I) Length = 300 Score = 30.0 bits (66), Expect = 7.7 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 7/55 (12%) Frame = -3 Query: 490 HFHAINNSVQCTKYRCC--NCPRSKSK---*KCAN*QCDCKEKN*QYY--RAGFY 347 H A+ +C K+ CC PRSKS +C +C C N + Y R FY Sbjct: 229 HTRAVIYMAECIKHECCLIGIPRSKSSQPISRCTKQECVCVGLNAKKYPSRGSFY 283
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,560,156 Number of Sequences: 369166 Number of extensions: 1666939 Number of successful extensions: 4174 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4054 length of database: 68,354,980 effective HSP length: 109 effective length of database: 48,218,865 effective search space used: 7570361805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)