Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_019_B20 (208 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q97LN7|PYRC_CLOAB Dihydroorotase (DHOase) 29 3.9 sp|P27801|PEP3_YEAST Vacuolar membrane protein PEP3 28 6.6
>sp|Q97LN7|PYRC_CLOAB Dihydroorotase (DHOase) Length = 424 Score = 28.9 bits (63), Expect = 3.9 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 18/75 (24%) Frame = +2 Query: 8 LIVLQDGFVVDGVHLWEGFILILVDDQEL--------HDSDVEQV----------FITLL 133 +I++++G+V+D + EG IL+D + + D D+E + FI + Sbjct: 1 MIIIKNGYVIDPLTKREGKFDILIDGENVVRISQDIGIDDDIEVIDAEDCIVSPGFIDIH 60 Query: 134 ISYRPPHRSQKENVI 178 +R P ++KE++I Sbjct: 61 SHFRDPGFTEKEDII 75
>sp|P27801|PEP3_YEAST Vacuolar membrane protein PEP3 Length = 918 Score = 28.1 bits (61), Expect = 6.6 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +2 Query: 35 VDGVHLWEGFILILVDDQELHDSDVEQVFITLLI 136 +DG+ WEG +L+ + D L+ DV + L++ Sbjct: 149 IDGIAYWEGSLLLTIKDNILYWRDVTNMKFPLVL 182
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,738,267 Number of Sequences: 369166 Number of extensions: 262744 Number of successful extensions: 527 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 527 length of database: 68,354,980 effective HSP length: 40 effective length of database: 60,965,580 effective search space used: 1707036240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)