Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_018_N14 (264 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8D2Z1|MURE_WIGBR UDP-N-acetylmuramoylalanyl-D-glutamate... 33 0.20 sp|Q8K9W5|PTA_BUCAP Phosphate acetyltransferase (Phosphotra... 31 0.76 sp|Q63912|OMGP_MOUSE Oligodendrocyte-myelin glycoprotein pr... 31 0.99 sp|P21422|RPOC_PLAFA DNA-directed RNA polymerase beta' chain 30 1.7 sp|P57392|GLPF_BUCAI Glycerol uptake facilitator protein 28 6.4 sp|Q6F0E4|TILS_MESFL tRNA(Ile)-lysidine synthase (tRNA(Ile)... 28 8.4
>sp|Q8D2Z1|MURE_WIGBR UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (UDP-N-acetylmuramyl-tripeptide synthetase) (Meso-diaminopimelate-adding enzyme) (UDP-MurNAc-tripeptide synthetase) Length = 496 Score = 33.1 bits (74), Expect = 0.20 Identities = 18/62 (29%), Positives = 29/62 (46%) Frame = +3 Query: 3 DIFVIVLFICNISRLNNHNNNFFFYPLQSIRCILFFQYMQIHRNALIFFFSKSNTIYFSN 182 DIF+ + CN H NF F +++ I+ + I ++ +I+F IYF N Sbjct: 38 DIFIALYGNCN------HGKNFIFEAIKNGSSIILIETKNILKHGIIYFIKNIPIIYFYN 91 Query: 183 HN 188 N Sbjct: 92 LN 93
>sp|Q8K9W5|PTA_BUCAP Phosphate acetyltransferase (Phosphotransacetylase) Length = 709 Score = 31.2 bits (69), Expect = 0.76 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = -1 Query: 249 LQRYSYVINSTSVEF--ELLKTDYDLKNKWYLI*KKKRLMRFYVFAYTEKKVCNGLIAMD 76 LQ++++ IN + F +LL+ NK +LI KK+ FY Y+ K+ C L + Sbjct: 339 LQKFNFNINVQNKYFINKLLEYTSSFFNKNHLISLKKKTTNFYKKTYSPKEFCYRLKILS 398 Query: 75 RKK 67 + K Sbjct: 399 KSK 401
>sp|Q63912|OMGP_MOUSE Oligodendrocyte-myelin glycoprotein precursor Length = 440 Score = 30.8 bits (68), Expect = 0.99 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 27 ICNISRLNNHNNNFFFYPLQSIRCILFFQYMQIHRN 134 + N++ L HNN F F P QS +L Q + +H N Sbjct: 190 LTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNN 225
>sp|P21422|RPOC_PLAFA DNA-directed RNA polymerase beta' chain Length = 575 Score = 30.0 bits (66), Expect = 1.7 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +3 Query: 18 VLFICNISRLNNHNNNFFFYPLQSIRCILFFQYMQIH 128 +LFI N+ + NNN FY L SI I+ YM I+ Sbjct: 539 ILFIFNLVWIKYINNNNIFYILTSINRIIINLYMYIY 575
>sp|P57392|GLPF_BUCAI Glycerol uptake facilitator protein Length = 263 Score = 28.1 bits (61), Expect = 6.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 3 DIFVIVLFICNISRLNNHNNNFFFY 77 +IF LFI + NN N+N+F Y Sbjct: 154 EIFSTALFILIVLEFNNRNSNYFLY 178
>sp|Q6F0E4|TILS_MESFL tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 398 Score = 27.7 bits (60), Expect = 8.4 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = -1 Query: 246 QRYSYVINSTSVEFELLKTDYDLKNKWYLI*K----KKRLMRFYVFAYTEKKVCN 94 + Y YVI + + ++L + K YLI K K R+++ V++ KK+ N Sbjct: 341 ENYPYVITNDFLTYKLNTYTFGKKTNRYLIDKKIRYKNRMLKAVVYSTKTKKILN 395
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,340,107 Number of Sequences: 369166 Number of extensions: 366630 Number of successful extensions: 773 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 773 length of database: 68,354,980 effective HSP length: 58 effective length of database: 57,640,350 effective search space used: 1671570150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)