Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_018_M12 (906 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P27571|XIST_MOUSE X inactive-specific transcript protein 32 2.4 sp|Q9TX43|CAR4_DICDI Cyclic AMP receptor 4 (cAMP receptor 4) 30 7.1
>sp|P27571|XIST_MOUSE X inactive-specific transcript protein Length = 298 Score = 32.0 bits (71), Expect = 2.4 Identities = 30/109 (27%), Positives = 54/109 (49%), Gaps = 3/109 (2%) Frame = +1 Query: 589 PILLCNLSI*T*HCCLISCFIYL*CYCFLINAVNICIPVR*LIFPIIISRNRL*-MC*VA 765 P++LC+ S+ C IS F L L++ VN C+ FP + L V+ Sbjct: 177 PLVLCSSSL----CQSISVFFLL-----LLSLVNSCLH----FFPAFLGPLSLFSFVFVS 223 Query: 766 LCFYCIFSIYLKYVSLLLP*CAVLCRYVI--AFICVPFVTS*LSSIILM 906 LC++ ++ Y+S++L C LC Y++ +F+ ++S S+ L+ Sbjct: 224 LCYW-----WISYLSIILLLCVCLCFYLLLSSFLFTLSISSLYKSVSLL 267
>sp|Q9TX43|CAR4_DICDI Cyclic AMP receptor 4 (cAMP receptor 4) Length = 443 Score = 30.4 bits (67), Expect = 7.1 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -1 Query: 783 NTIETQRNSTHL*TISRNNNWENQLSNRNADIYSIDEK 670 N+ E + S L TI NNN+ N +N N + I+EK Sbjct: 396 NSFEITQPSNDLNTIENNNNYNNNNNNNNNNSLVIEEK 433
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,138,121 Number of Sequences: 369166 Number of extensions: 1840059 Number of successful extensions: 3811 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3804 length of database: 68,354,980 effective HSP length: 110 effective length of database: 48,034,130 effective search space used: 9174518830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)