Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_018_K17 (265 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P62255|UB2G1_RAT Ubiquitin-conjugating enzyme E2 G1 (Ubi... 67 1e-11 sp|P34477|UBC7_CAEEL Probable ubiquitin-conjugating enzyme ... 67 1e-11 sp|Q42541|UBCD_ARATH Ubiquitin-conjugating enzyme E2 13 (Ub... 65 5e-11 sp|P42747|UBC14_ARATH Ubiquitin-conjugating enzyme E2 14 (U... 65 6e-11 sp|Q42540|UBC7_ARATH Ubiquitin-conjugating enzyme E2 7 (Ubi... 64 1e-10 sp|Q9Y818|UBC15_SCHPO Ubiquitin-conjugating enzyme E2 15 (U... 63 2e-10 sp|P25868|UBC7_WHEAT Ubiquitin-conjugating enzyme E2 7 (Ubi... 62 4e-10 sp|P14682|UBC3_YEAST Ubiquitin-conjugating enzyme E2-34 kDa... 50 2e-06 sp|P25869|UBC_ASFM2 Ubiquitin-conjugating enzyme E2-21 kDa ... 46 3e-05 sp|P27949|UBC_ASFB7 Ubiquitin-conjugating enzyme E2-21 kDa ... 46 3e-05
>sp|P62255|UB2G1_RAT Ubiquitin-conjugating enzyme E2 G1 (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) sp|P62254|UB2G1_MOUSE Ubiquitin-conjugating enzyme E2 G1 (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) sp|P62253|UB2G1_HUMAN Ubiquitin-conjugating enzyme E2 G1 (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 170 Score = 67.0 bits (162), Expect = 1e-11 Identities = 34/44 (77%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = +2 Query: 2 SVISMLAEPNADSPANVDAAKDFRENFS-EFKRKVQRCVRRSQE 130 SVISMLA+PN DSPANVDAAK++RE+ + EFKRKV RCVR+SQE Sbjct: 123 SVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQE 166
>sp|P34477|UBC7_CAEEL Probable ubiquitin-conjugating enzyme E2 7 (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 164 Score = 67.0 bits (162), Expect = 1e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +2 Query: 2 SVISMLAEPNADSPANVDAAKDFRENFSEFKRKVQRCVRRSQE 130 SVISML +PN +SPANVDAAK REN++EFK+KV +CVRRSQE Sbjct: 121 SVISMLTDPNFESPANVDAAKMQRENYAEFKKKVAQCVRRSQE 163
>sp|Q42541|UBCD_ARATH Ubiquitin-conjugating enzyme E2 13 (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 166 Score = 65.1 bits (157), Expect = 5e-11 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = +2 Query: 2 SVISMLAEPNADSPANVDAAKDFRENFSEFKRKVQRCVRRSQECF 136 S+ISML+ PN +SPANV+AAK++RE EFK+KV RCVR+SQE F Sbjct: 122 SIISMLSGPNDESPANVEAAKEWREKRDEFKKKVSRCVRKSQEMF 166
>sp|P42747|UBC14_ARATH Ubiquitin-conjugating enzyme E2 14 (Ubiquitin-protein ligase 14) (Ubiquitin carrier protein 14) (TAYO29) Length = 167 Score = 64.7 bits (156), Expect = 6e-11 Identities = 29/43 (67%), Positives = 39/43 (90%) Frame = +2 Query: 2 SVISMLAEPNADSPANVDAAKDFRENFSEFKRKVQRCVRRSQE 130 S+ISML+ PN +SPANV+AAK++R+N +EF++KV RCVRRSQE Sbjct: 123 SIISMLSGPNDESPANVEAAKEWRDNRAEFRKKVSRCVRRSQE 165
>sp|Q42540|UBC7_ARATH Ubiquitin-conjugating enzyme E2 7 (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 166 Score = 63.9 bits (154), Expect = 1e-10 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = +2 Query: 2 SVISMLAEPNADSPANVDAAKDFRENFSEFKRKVQRCVRRSQECF 136 S+ISML+ PN +SPANV+AAK++R+ EFK+KV RCVR+SQE F Sbjct: 122 SIISMLSGPNDESPANVEAAKEWRDKRDEFKKKVSRCVRKSQEMF 166
>sp|Q9Y818|UBC15_SCHPO Ubiquitin-conjugating enzyme E2 15 (Ubiquitin-protein ligase 15) (Ubiquitin carrier protein 15) Length = 167 Score = 62.8 bits (151), Expect = 2e-10 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = +2 Query: 2 SVISMLAEPNADSPANVDAAKDFRENFSEFKRKVQRCVRRSQE 130 SVISML+ PN +SPAN+DAAK+FREN EFK++V+R VRRS E Sbjct: 123 SVISMLSSPNDESPANIDAAKEFRENPQEFKKRVRRLVRRSIE 165
>sp|P25868|UBC7_WHEAT Ubiquitin-conjugating enzyme E2 7 (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 168 Score = 62.0 bits (149), Expect = 4e-10 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = +2 Query: 2 SVISMLAEPNADSPANVDAAKDFRENFSEFKRKVQRCVRRSQE 130 S+ISML+ PN +SPAN++AAKD+RE EFK+KV+R VR+SQE Sbjct: 124 SIISMLSSPNDESPANIEAAKDWREKQDEFKKKVRRAVRKSQE 166
>sp|P14682|UBC3_YEAST Ubiquitin-conjugating enzyme E2-34 kDa (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Cell division control protein 34) Length = 295 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/43 (48%), Positives = 35/43 (81%) Frame = +2 Query: 2 SVISMLAEPNADSPANVDAAKDFRENFSEFKRKVQRCVRRSQE 130 S++S+L +PN +SPANVDAA D+R+N ++K++V+ V RS++ Sbjct: 127 SIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERSKQ 169
>sp|P25869|UBC_ASFM2 Ubiquitin-conjugating enzyme E2-21 kDa (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 213 Score = 45.8 bits (107), Expect = 3e-05 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +2 Query: 2 SVISMLAEPNADSPANVDAAKDFR-----ENFSEFKRKVQRCVRRS-QEC 133 SVIS+L EPN DSPANVDAAK +R E+ + +V++ V++S EC Sbjct: 113 SVISLLNEPNPDSPANVDAAKSYRKYLYKEDLESYPMEVKKTVKKSLDEC 162
>sp|P27949|UBC_ASFB7 Ubiquitin-conjugating enzyme E2-21 kDa (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 215 Score = 45.8 bits (107), Expect = 3e-05 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +2 Query: 2 SVISMLAEPNADSPANVDAAKDFR-----ENFSEFKRKVQRCVRRS-QEC 133 SVIS+L EPN DSPANVDAAK +R E+ + +V++ V++S EC Sbjct: 113 SVISLLNEPNPDSPANVDAAKSYRKYVYKEDLESYPMEVKKTVKKSLDEC 162
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,845,639 Number of Sequences: 369166 Number of extensions: 312382 Number of successful extensions: 1089 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1077 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1088 length of database: 68,354,980 effective HSP length: 58 effective length of database: 57,640,350 effective search space used: 1671570150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)