Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_018_I03 (238 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9CQI6|COTL1_MOUSE Coactosin-like protein 49 3e-06 sp|Q14019|COTL1_HUMAN Coactosin-like protein 48 6e-06 sp|Q8VHQ7|SYTL4_RAT Synaptotagmin-like protein 4 (Exophilin... 29 3.9 sp|Q96C24|SYTL4_HUMAN Synaptotagmin-like protein 4 (Exophil... 28 6.6 sp|Q9R0Q1|SYTL4_MOUSE Synaptotagmin-like protein 4 (Exophil... 28 8.6
>sp|Q9CQI6|COTL1_MOUSE Coactosin-like protein Length = 142 Score = 49.3 bits (116), Expect = 3e-06 Identities = 23/47 (48%), Positives = 33/47 (70%) Frame = +1 Query: 1 KANLTVDKSLVKEVVASYAVDLFTSDKNEITESKLRAALEKAGGANY 141 +A DK+LVKEVV ++A + SD+ E+ E +R+ L+KAGGANY Sbjct: 91 RAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIRSELKKAGGANY 137
>sp|Q14019|COTL1_HUMAN Coactosin-like protein Length = 142 Score = 48.1 bits (113), Expect = 6e-06 Identities = 22/47 (46%), Positives = 33/47 (70%) Frame = +1 Query: 1 KANLTVDKSLVKEVVASYAVDLFTSDKNEITESKLRAALEKAGGANY 141 +A DK+LVKEVV ++A + SD+ E+ E +++ L+KAGGANY Sbjct: 91 RAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANY 137
>sp|Q8VHQ7|SYTL4_RAT Synaptotagmin-like protein 4 (Exophilin-2) (Granuphilin) Length = 672 Score = 28.9 bits (63), Expect = 3.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 123 SWRC*LWISKINYK*FQNDYFYQNLINKFVF 215 SWRC + +I K D+FY +N+F + Sbjct: 99 SWRCKVCSKEIELKKATGDWFYDQKVNRFAY 129
>sp|Q96C24|SYTL4_HUMAN Synaptotagmin-like protein 4 (Exophilin-2) (Granuphilin) Length = 671 Score = 28.1 bits (61), Expect = 6.6 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 123 SWRC*LWISKINYK*FQNDYFYQNLINKFVF 215 +WRC + +I K D+FY +N+F + Sbjct: 99 TWRCKVCAKEIELKKATGDWFYDQKVNRFAY 129
>sp|Q9R0Q1|SYTL4_MOUSE Synaptotagmin-like protein 4 (Exophilin-2) (Granuphilin) Length = 673 Score = 27.7 bits (60), Expect = 8.6 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 123 SWRC*LWISKINYK*FQNDYFYQNLINKF 209 SWRC + +I K D+FY +N+F Sbjct: 99 SWRCKVCSKEIELKKATGDWFYDQKVNRF 127
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,137,361 Number of Sequences: 369166 Number of extensions: 197606 Number of successful extensions: 547 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 547 length of database: 68,354,980 effective HSP length: 49 effective length of database: 59,302,965 effective search space used: 1719785985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)