Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_017_K19 (896 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q05079|F16P_KLULA Fructose-1,6-bisphosphatase (D-fructos... 31 5.4 sp|Q9CPP7|LIPG_MOUSE Gastric triacylglycerol lipase precurs... 30 7.0 sp|P75177|DPO3X_MYCPN DNA polymerase III subunit gamma/tau 30 7.0 sp|P80035|LIPG_CANFA Gastric triacylglycerol lipase precurs... 30 7.0 sp|O75106|AOC2_HUMAN Retina-specific copper amine oxidase p... 30 9.1 sp|Q88P80|NDPA_PSEPK Nucleoid-associated protein ndpA 30 9.1
>sp|Q05079|F16P_KLULA Fructose-1,6-bisphosphatase (D-fructose-1,6-bisphosphate 1-phosphohydrolase) (FBPase) Length = 355 Score = 30.8 bits (68), Expect = 5.4 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 2/73 (2%) Frame = +1 Query: 337 MIPFRNSMGTCWTAGVPICGAGRLMKRSSAGKIVSHSIMNSRVHGHSNMENARITFYRIS 516 +I FRNS G PI G+ L S G IVS ++ +G+S E++ T ++ Sbjct: 112 LIVFRNSPGKYAVCCDPIDGSSNLDAGVSVGTIVSLFKIHENQNGNSGEEDSEGTINDVA 171 Query: 517 T--RRLILLCFSL 549 R ++ C+++ Sbjct: 172 RCGREMVAACYTM 184
>sp|Q9CPP7|LIPG_MOUSE Gastric triacylglycerol lipase precursor (Gastric lipase) (GL) Length = 395 Score = 30.4 bits (67), Expect = 7.0 Identities = 16/57 (28%), Positives = 25/57 (43%) Frame = +3 Query: 363 YVLDSGGADLWCGEINEEEFRRKNCFSFDHEQSSAWSFKHGEREDYILSDIDKTSDF 533 ++L G D+W G + RKN + + + W+F E Y D+ T DF Sbjct: 103 FILADAGYDVWLGNSRGNTWSRKNVY-YSPDSVEFWAFSFDEMAKY---DLPATIDF 155
>sp|P75177|DPO3X_MYCPN DNA polymerase III subunit gamma/tau Length = 681 Score = 30.4 bits (67), Expect = 7.0 Identities = 14/56 (25%), Positives = 28/56 (50%) Frame = +3 Query: 501 ILSDIDKTSDFALFLVAVMENETMPIKCWKWSEIFKYHQLSGDKSESRMPTVVSLE 668 +L +++ D+ LF+ A E +PI + F + Q++ D + R+ V + E Sbjct: 137 LLKTLEEAPDYVLFIFATTEFNKIPITILSRCQSFFFKQITNDLIQQRLAEVAAKE 192
>sp|P80035|LIPG_CANFA Gastric triacylglycerol lipase precursor (Gastric lipase) (GL) Length = 398 Score = 30.4 bits (67), Expect = 7.0 Identities = 16/59 (27%), Positives = 26/59 (44%) Frame = +3 Query: 363 YVLDSGGADLWCGEINEEEFRRKNCFSFDHEQSSAWSFKHGEREDYILSDIDKTSDFAL 539 ++L G D+W G + R+N + + + W+F E Y D+ T DF L Sbjct: 104 FILADAGYDVWLGNSRGNTWARRNLY-YSPDSVEFWAFSFDEMAKY---DLPATIDFIL 158
>sp|O75106|AOC2_HUMAN Retina-specific copper amine oxidase precursor (RAO) (Amine oxidase [copper-containing]) Length = 756 Score = 30.0 bits (66), Expect = 9.1 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = -3 Query: 405 SPRTTNRHPRCPARTHRIAEWNHSSGQTRAYPSCAKRDL 289 SP +++ P CP+ +HR W H GQ++ + ++ +L Sbjct: 27 SPGGSSQPPHCPSVSHRAQPWPH-PGQSQLFADLSREEL 64
>sp|Q88P80|NDPA_PSEPK Nucleoid-associated protein ndpA Length = 335 Score = 30.0 bits (66), Expect = 9.1 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 5/46 (10%) Frame = +3 Query: 441 SFDHEQSSAWSFKHGEREDYILSD-----IDKTSDFALFLVAVMEN 563 S++ +Q AW F HGE Y LS +D+ DF F +E+ Sbjct: 45 SYNAKQGKAWGFFHGESGAYPLSGWLKQYLDEEKDFTAFSRVAVEH 90
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,969,754 Number of Sequences: 369166 Number of extensions: 2162463 Number of successful extensions: 5444 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5258 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5443 length of database: 68,354,980 effective HSP length: 110 effective length of database: 48,034,130 effective search space used: 9030416440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)